DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2113 and ABRA

DIOPT Version :10

Sequence 1:NP_647757.2 Gene:CG2113 / 38356 FlyBaseID:FBgn0035384 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_631905.1 Gene:ABRA / 137735 HGNCID:30655 Length:381 Species:Homo sapiens


Alignment Length:152 Identity:51/152 - (33%)
Similarity:81/152 - (53%) Gaps:8/152 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AESQESPQDSSVSSRITLFNQQAEQHKNWMMINPFAH---YNVNEMPKRTFPEEEYGRAPTGSLS 63
            |:.:.||    |.:....:.|.|::|.....:|||:.   |.:....:....:|.|||...|:.:
Human   235 AQQKYSP----VGNLKGRWQQWADEHIQSQKLNPFSEEFDYELAMSTRLHKGDEGYGRPKEGTKT 295

  Fly    64 EQRSLQANVRALEEILQLCDLIQKSGRDDPIDGRKVLAFGQLFETYNNISDKLLATLLGARKYGF 128
            .:|:.:|......|::.:|.:|....|... ||:..:.||.||:.|..||||::..|:.|||:|.
Human   296 AERAKRAEEHIYREMMDMCFIICTMARHRR-DGKIQVTFGDLFDRYVRISDKVVGILMRARKHGL 359

  Fly   129 VDFSGETLFQGRDDTEPVRLLR 150
            |||.||.|:|||||...:.||:
Human   360 VDFEGEMLWQGRDDHVVITLLK 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2113NP_647757.2 Costars 75..149 CDD:464274 31/73 (42%)
ABRANP_631905.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..156
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..207
Actin-binding 1. /evidence=ECO:0000250 199..299 16/67 (24%)
Interaction with actin. /evidence=ECO:0000250|UniProtKB:Q8BUZ1 240..285 10/48 (21%)
Actin-binding 2. /evidence=ECO:0000250 300..381 33/81 (41%)
Costars 305..380 CDD:464274 31/75 (41%)
Interaction with actin. /evidence=ECO:0000250|UniProtKB:Q8BUZ1 352..381 16/28 (57%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.