powered by:
Protein Alignment CG2113 and LOC105947410
DIOPT Version :9
Sequence 1: | NP_647757.2 |
Gene: | CG2113 / 38356 |
FlyBaseID: | FBgn0035384 |
Length: | 183 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_012819057.2 |
Gene: | LOC105947410 / 105947410 |
-ID: | - |
Length: | 984 |
Species: | Xenopus tropicalis |
Alignment Length: | 71 |
Identity: | 19/71 - (26%) |
Similarity: | 29/71 - (40%) |
Gaps: | 11/71 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 90 RDDPIDGRKVLAFGQLFETYNNISDKLLATLLGARKY---------GFVDFSGETLFQGRDDTEP 145
|:.| |.|.|.:|.:.|..:..:|.||..|:..|.. .|..:||..:...:....|
Frog 668 RNTP--GIKGLTYGNIKEKVSLYADDLLVYLVDPRDSLTSLLQLVDNFGHYSGLRINWDKSILCP 730
Fly 146 VRLLRP 151
|..|:|
Frog 731 VDPLQP 736
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1328485at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.