DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2113 and LOC105947410

DIOPT Version :9

Sequence 1:NP_647757.2 Gene:CG2113 / 38356 FlyBaseID:FBgn0035384 Length:183 Species:Drosophila melanogaster
Sequence 2:XP_012819057.2 Gene:LOC105947410 / 105947410 -ID:- Length:984 Species:Xenopus tropicalis


Alignment Length:71 Identity:19/71 - (26%)
Similarity:29/71 - (40%) Gaps:11/71 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 RDDPIDGRKVLAFGQLFETYNNISDKLLATLLGARKY---------GFVDFSGETLFQGRDDTEP 145
            |:.|  |.|.|.:|.:.|..:..:|.||..|:..|..         .|..:||..:...:....|
 Frog   668 RNTP--GIKGLTYGNIKEKVSLYADDLLVYLVDPRDSLTSLLQLVDNFGHYSGLRINWDKSILCP 730

  Fly   146 VRLLRP 151
            |..|:|
 Frog   731 VDPLQP 736

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2113NP_647757.2 Costars 75..148 CDD:291377 17/66 (26%)
LOC105947410XP_012819057.2 L1-EN 6..232 CDD:197310
RT_nLTR_like 504..758 CDD:238827 19/71 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1328485at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.