DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2113 and abra

DIOPT Version :9

Sequence 1:NP_647757.2 Gene:CG2113 / 38356 FlyBaseID:FBgn0035384 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001106590.1 Gene:abra / 100127806 XenbaseID:XB-GENE-948438 Length:227 Species:Xenopus tropicalis


Alignment Length:132 Identity:48/132 - (36%)
Similarity:73/132 - (55%) Gaps:10/132 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 AEQHKNWMMINPFAHYNVNE--MPKRTFP-EEEYGRAPTGSLSEQRSLQANVRALEEILQLCDLI 85
            :.||.....:|||:....:|  |.:|... ::.||....|:.:.:|:::|......|:..||.:|
 Frog   100 SNQHALTQKLNPFSEEFDHEFAMSRRLHKGDKGYGHPEEGTKTAERAMRAEAHIHREMKDLCFII 164

  Fly    86 ---QKSGRDDPIDGRKVLAFGQLFETYNNISDKLLATLLGARKYGFVDFSGETLFQGRDDTEPVR 147
               .|.|:    ||:..:.||:||:.|..||||::..||.|||:..|||.||.|:|||||...:.
 Frog   165 STMSKPGK----DGKVRVTFGELFDRYVRISDKVVGILLRARKHDMVDFPGEMLWQGRDDHVIIT 225

  Fly   148 LL 149
            ||
 Frog   226 LL 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2113NP_647757.2 Costars 75..148 CDD:291377 33/75 (44%)
abraNP_001106590.1 Costars 152..226 CDD:291377 33/77 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002921
OrthoInspector 1 1.000 - - mtm9342
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.