DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CPT2 and DRP4A

DIOPT Version :9

Sequence 1:NP_647756.1 Gene:CPT2 / 38355 FlyBaseID:FBgn0035383 Length:667 Species:Drosophila melanogaster
Sequence 2:NP_176253.1 Gene:DRP4A / 842348 AraportID:AT1G60530 Length:301 Species:Arabidopsis thaliana


Alignment Length:211 Identity:44/211 - (20%)
Similarity:75/211 - (35%) Gaps:68/211 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 MNAKKSDTSSYRRWMKVAPKAFATYASYAFKAF-----------------PLDMSQYNR------ 215
            |..::|.:.....|::.:.|...|...:..:|.                 ||.:|....      
plant   101 MRLQRSSSPEPEIWLEYSDKVVPTDEEHVAEAICAATDVIAGTGEGVSDTPLTLSVKKNNVPDLT 165

  Fly   216 ---LFGTSRIPRIGKDELVQSPDAKHILVMRRGHMYAVNVLDSSGYIE-SPSVILGRLRAVLKLD 276
               |.|.:|:|..|:.|.:....::  ::|:              ||| ..|:||..|.|.:...
plant   166 MVDLPGITRVPVNGQPENIYEQISR--MIMK--------------YIEPQESIILNVLSATVDFT 214

  Fly   277 ADREAASVPLGVLTSGQRDEWAKTRQHFVSNTKNAD-----LLER----EVDAALFCVCLD---G 329
            ...       .:..|.|.|   ||.:..::....||     ||::    :|...|..:|:.   |
plant   215 TCE-------SIRMSRQVD---KTGERTLAVVTKADMAPEGLLQKVTADDVSIGLGYICVRNRIG 269

  Fly   330 EEDGVFNENQ-QEPLL 344
            ||  .:.|.: ||.||
plant   270 EE--TYEEARVQEDLL 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CPT2NP_647756.1 Carn_acyltransf 45..655 CDD:279140 44/211 (21%)
DRP4ANP_176253.1 DLP_1 60..300 CDD:206738 44/211 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.