DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or63a and Or19a

DIOPT Version :9

Sequence 1:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_525013.2 Gene:Or19a / 59214 FlyBaseID:FBgn0041626 Length:387 Species:Drosophila melanogaster


Alignment Length:236 Identity:50/236 - (21%)
Similarity:88/236 - (37%) Gaps:33/236 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 LYPAWEHKGLEFPYY---HIQMYLETCSLYICGMCA--------VSFDGVFIVL-CLHSVGLMRS 246
            :||.|      .|:.   ....||.|..|:...:.|        .|:.|.:::| .:|:..|...
  Fly   157 MYPTW------IPWNWRDSTSAYLATAMLHTTALMANATLVLNLSSYPGTYLILVSVHTKALALR 215

  Fly   247 LNQMVEQATSELVPPDRRVEYLRCCIYQYQRVANFATEVNNCFRHITFTQFLLSLFNWGLALFQM 311
            ::::...|.   :|..|....|...|:.:|.:......:........|.||      :..|..|.
  Fly   216 VSKLGYGAP---LPAVRMQAILVGYIHDHQIILRLFKSLERSLSMTCFLQF------FSTACAQC 271

  Fly   312 SVG----LGNNSSITMIRMTMYLVAAGYQIVVYCYNGQRFATASEEIANAFYQVRWYGESREFRH 372
            ::.    .||...:..:.|...||....:.::.||..:......|.:..|.|...|..:|..||.
  Fly   272 TICYFLLFGNVGIMRFMNMLFLLVILTTETLLLCYTAELPCKEGESLLTAVYSCNWLSQSVNFRR 336

  Fly   373 LIRMMLMRTNRGFRLDVSWFMQMSLPTLMAMVRTSGQYFLL 413
            |:.:||.|......|.....:.:|:.|...|::  |.|.:|
  Fly   337 LLLLMLARCQIPMILVSGVIVPISMKTFTVMIK--GAYTML 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 47/229 (21%)
Or19aNP_525013.2 7tm_6 65..372 CDD:251636 48/231 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465173
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.