DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or63a and Or98a

DIOPT Version :9

Sequence 1:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster


Alignment Length:365 Identity:67/365 - (18%)
Similarity:124/365 - (33%) Gaps:82/365 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 TALQ-FLTSIAKMWYFLFAHRQIYELLR-KARCHELLQKC-ELFERMSDLPVIKEIRQQVESTMN 141
            |.:| |..|:...:..||.:..|....: |....|:.::| .|.||:       |:.|.|.....
  Fly    80 TVMQLFFNSVGMPFKVLFFNLYISGFYKAKKLLSEMDKRCTTLKERV-------EVHQGVVRCNK 137

  Fly   142 RYWASTRRQILIYLYSCICITTNYFINSF------------VINLYRYFTKPKGSYDIMLPLPSL 194
            .|        |||.:    |.|.|.|::|            :.|.:..|.:.:.|:         
  Fly   138 AY--------LIYQF----IYTAYTISTFLSAALSGKLPWRIYNPFVDFRESRSSF--------- 181

  Fly   195 YPAWEHKGLEFPYYHIQMYLETCSLYICGMCAVSFDGVF-----IVLCLHSVGLMRSLNQMVEQA 254
               |            :..|...:|.:..:.......::     ::|.:|    ::.|...||..
  Fly   182 ---W------------KAALNETALMLFAVTQTLMSDIYPLLYGLILRVH----LKLLRLRVESL 227

  Fly   255 TSELVPPDRRVEY-LRCCIYQYQRVANFATEVNNCFRHITFTQFLLSLFNWGLA----LFQMSVG 314
            .::....|...|. |..||..:..:.::|..:........|.||||.....||:    ||...:.
  Fly   228 CTDSGKSDAENEQDLIKCIKDHNLIIDYAAAIRPAVTRTIFVQFLLIGICLGLSMINLLFFADIW 292

  Fly   315 LGNNSSITMIRMTMYLVAAGYQIVVYCYNGQRFATASEEIANAFYQVRWYGESREFRHLIRMMLM 379
            .|       :....|:.....|...:|:.........|.:.:|.:...|...||.::..:|..|.
  Fly   293 TG-------LATVAYINGLMVQTFPFCFVCDLLKKDCELLVSAIFHSNWINSSRSYKSSLRYFLK 350

  Fly   380 RTNRGFRLDVSWFMQMSLPTLMAMVRTSGQYFLLLQNVNQ 419
            ...:...........:|..:.:.:.:.:   |.::..|||
  Fly   351 NAQKSIAFTAGSIFPISTGSNIKVAKLA---FSVVTFVNQ 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 63/352 (18%)
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 63/355 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465181
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.