DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or63a and Or85b

DIOPT Version :9

Sequence 1:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster


Alignment Length:392 Identity:85/392 - (21%)
Similarity:174/392 - (44%) Gaps:61/392 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 WTIVLSVSSLA---SLYGHWQML-ARYIHDIPRIGETAGTALQFLT-SIAKMWYFLFAHRQIYEL 104
            |:.|:::|.:.   |:|.:...: .:::..:     ||.:.:.|:| .::||::..:....|.||
  Fly    38 WSNVINLSFVGLFESIYVYSAFMDNKFLEAV-----TALSYIGFVTVGMSKMFFIRWKKTAITEL 97

  Fly   105 LRKARCHELLQKCELFERMSDLPVIKEIRQQVESTMNRYWASTRRQILIY--LYSCICITTNYFI 167
            :.:.:  |:.....:.|...:||:              |..:..|..|||  |||.:..|.|.|.
  Fly    98 INELK--EIYPNGLIREERYNLPM--------------YLGTCSRISLIYSLLYSVLIWTFNLFC 146

  Fly   168 NSFVINLYRYFTKPKGSYDIML-------PLPSL-YPAWEHKGLEFPYYHIQMYLETCSLYICGM 224
                  :..|:.     ||..|       .||.| |..|:.:. .:.||.: ::.:..:.|....
  Fly   147 ------VMEYWV-----YDKWLNIRVVGKQLPYLMYIPWKWQD-NWSYYPL-LFSQNFAGYTSAA 198

  Fly   225 CAVSFDGVFIVLCLHSVGLMRSL----NQMVEQATSELVPPDRRVEYLRCCIYQYQRVANFATEV 285
            ..:|.|   ::||..:..|:...    |.|.....|.....|.|  :|...:..::|:...:..|
  Fly   199 GQISTD---VLLCAVATQLVMHFDFLSNSMERHELSGDWKKDSR--FLVDIVRYHERILRLSDAV 258

  Fly   286 NNCFRHITFTQFLLSLFNWGLALFQMSVGLGNNSSITMIRMTMYLVAAGYQIVVYCYNGQRFATA 350
            |:.|.......|::|.|......|||:||:..:   .::::.::||::..|:.:.|:.||..|.|
  Fly   259 NDIFGIPLLLNFMVSSFVICFVGFQMTVGVPPD---IVVKLFLFLVSSMSQVYLICHYGQLVADA 320

  Fly   351 SEEIANAFYQVRWYGESREFRHLIRMMLMRTNRGFRLDVSWFMQMSLPTLMAMVRTSGQYFLLLQ 415
            |...:.|.|..:||.....::..:.:::.|:.:...|..:.|:.::..|:..:::.|.::|.||:
  Fly   321 SYGFSVATYNQKWYKADVRYKRALVIIIARSQKVTFLKATIFLDITRSTMTDLLQISYKFFALLR 385

  Fly   416 NV 417
            .:
  Fly   386 TM 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 76/346 (22%)
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 76/355 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465360
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.