DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or63a and Or83a

DIOPT Version :9

Sequence 1:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_524234.2 Gene:Or83a / 40648 FlyBaseID:FBgn0037322 Length:453 Species:Drosophila melanogaster


Alignment Length:335 Identity:61/335 - (18%)
Similarity:112/335 - (33%) Gaps:81/335 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 MNRYWASTRRQILIYLYSCICITTNYFINSFVINLYRYFTKPKGSYDIMLPLPSLYPAWEHKGLE 204
            |::.|..|      |:|.|      |....|.:.|      |....|..|||...||        
  Fly   145 MSKLWIKT------YVYCC------YIGTIFWLAL------PIAYRDRSLPLACWYP-------- 183

  Fly   205 FPY-----YHIQMYLETCSLYICGMCAVSFDGVFIVLCLHSVGL--------------------- 243
            |.|     |.:...|:............|..|:.:|||:...|.                     
  Fly   184 FDYTQPGVYEVVFLLQAMGQIQVAASFASSSGLHMVLCVLISGQYDVLFCSLKNVLASSYVLMGA 248

  Fly   244 -MRSLNQM-VEQATSELVPPDR--------------------------RVEYLRCCIYQYQRVAN 280
             |..|||: .||:.:::.|...                          |:.::| ||..::.:..
  Fly   249 NMTELNQLQAEQSAADVEPGQYAYSVEEETPLQELLKVGSSMDFSSAFRLSFVR-CIQHHRYIVA 312

  Fly   281 FATEVNNCFRHITFTQFLLSLFNWGLALFQMSVGLGNNSSITMIRMTMYLVAAGYQIVVYCYNGQ 345
            ...::.:.:..|.|.:.....|...|..|..:.....||.:.|:.:..||:...|::.:.||...
  Fly   313 ALKKIESFYSPIWFVKIGEVTFLMCLVAFVSTKSTAANSFMRMVSLGQYLLLVLYELFIICYFAD 377

  Fly   346 RFATASEEIANAFYQVRWYGESREFRHLIRMMLMRTNRGFRLDVSWFMQMSLPTLMAMVRTSGQY 410
            .....|:....|.::..|....::.|......::.:.|.|:|.......:::......:.|:..:
  Fly   378 IVFQNSQRCGEALWRSPWQRHLKDVRSDYMFFMLNSRRQFQLTAGKISNLNVDRFRGTITTAFSF 442

  Fly   411 FLLLQNVNQK 420
            ..|||.::.:
  Fly   443 LTLLQKMDAR 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 58/321 (18%)
Or83aNP_524234.2 7tm_6 <155..440 CDD:251636 54/305 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.