DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or63a and Or74a

DIOPT Version :9

Sequence 1:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_524123.1 Gene:Or74a / 39929 FlyBaseID:FBgn0036709 Length:404 Species:Drosophila melanogaster


Alignment Length:373 Identity:69/373 - (18%)
Similarity:150/373 - (40%) Gaps:82/373 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 WYFLFAHRQ----------IYELL--RKARCHELLQKCELFERM-----SDLPVIKEIRQQVEST 139
            :::|.|:||          .|.:|  .:.||.:|....:.|..:     :::.|.:|:...:.::
  Fly    66 FHYLIANRQDMDNMLTGLPTYLILVEMQIRCFQLAWHKDRFRALLQRFYAEIYVSEEMEPHLFAS 130

  Fly   140 MNRYWASTRRQILIYLYSCICITTNYF---INSFVIN----LYRYFTKPKGSYDIMLPLPSLYPA 197
            :.|...:||....:||.:.:    |:|   :.:.:.:    ||:                .:|| 
  Fly   131 IQRQMLATRVNSTVYLLALL----NFFLVPVTNVIYHRREMLYK----------------QVYP- 174

  Fly   198 WEHKGLEF--PYYHIQM---YLETCSLY----ICGMCAVSFDGVFIVLCLHSVGLMRSLNQMVEQ 253
            :::..|.|  |...:..   ::.|..|:    :.|...:..:..:|.|   ...|.||...::::
  Fly   175 FDNTQLHFFIPLLVLNFWVGFIITSMLFGELNVMGELMMHLNARYIQL---GQDLRRSAQMLLKK 236

  Fly   254 ATSELVPPDRRVEYLRCCIYQYQRVANFATEVNNCFRHITFTQFLLSLFNWGL--ALF--QMSVG 314
            ::|..|....|:. |...:.:...:.:|...|.   :..|...|::..|:.||  |||  ..:..
  Fly   237 SSSLNVAIAYRLN-LTHILRRNAALRDFGQRVE---KEFTLRIFVMFAFSAGLLCALFFKAFTNP 297

  Fly   315 LGNNSSIT-MIRMTMYLVAAGYQIVVYCYNGQRFATASEEIANAFYQVRW---------YGESRE 369
            .||.:.|. .:...|.|:|.|..       |......::|:...:|...|         .||:.:
  Fly   298 WGNVAYIVWFLAKFMELLALGML-------GSILLKTTDELGMMYYTADWEQVIHQSDNVGENVK 355

  Fly   370 FRHLIRMMLMRTNRGFRLDVSWFMQMSLPTLMAMVRTSGQYFLLLQNV 417
            ...|:.:.:...:|.|.:....:.::||..::.:::.:..||..|.::
  Fly   356 LMKLVTLAIQLNSRPFFITGLNYFRVSLTAVLKIIQGAFSYFTFLNSM 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 66/362 (18%)
Or74aNP_524123.1 7tm_6 75..394 CDD:251636 62/353 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465368
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.