DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or63a and Or59a

DIOPT Version :9

Sequence 1:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_523821.1 Gene:Or59a / 37711 FlyBaseID:FBgn0026384 Length:379 Species:Drosophila melanogaster


Alignment Length:365 Identity:79/365 - (21%)
Similarity:126/365 - (34%) Gaps:94/365 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 LFAHRQIYE----LLRKARCHELLQKCELF----------ERMSDLPVIKEIRQQVESTMNRYWA 145
            ||.:|.|.|    |...|.|.....||.|:          ||:  |.::.|  :.|.......:.
  Fly    59 LFRNRTITEDILNLTTFATCTACSVKCLLYAYNIKDVLEMERL--LRLLDE--RVVGPEQRSIYG 119

  Fly   146 STRRQILIYLYSCICITTNYFINSFVINLYRYFTKPKGSYDIMLPLPSLYPAWEHKGLEFPY--- 207
            ..|.|:...||..|.|   |...:....|...|.:.:|         .:||||      ||:   
  Fly   120 QVRVQLRNVLYVFIGI---YMPCALFAELSFLFKEERG---------LMYPAW------FPFDWL 166

  Fly   208 -----YHI--------------QMYLETCSLYICGMCAVSFDGVFIVLCLHSVGLMRSLNQMVEQ 253
                 |:|              |.|:..|           |..|  ||||.|..:....|:..|.
  Fly   167 HSTRNYYIANAYQIVGISFQLLQNYVSDC-----------FPAV--VLCLISSHIKMLYNRFEEV 218

  Fly   254 ATSELVPPDRRVEY-LRCCIYQYQRVANFATEVNNCFRHITFTQFLLSLFN--WGLALFQMSVGL 315
            .    :.|.|..|. |..||..::.:......:..........||.::..|  .|||.....|  
  Fly   219 G----LDPARDAEKDLEACITDHKHILELFRRIEAFISLPMLIQFTVTALNVCIGLAALVFFV-- 277

  Fly   316 GNNSSITMIRM--TMYLVAAGYQIVVYCYNGQRFATASE----EIANAFYQVRWYGESREFRHLI 374
                |..|.||  ..|.:|...||...|:    |.|.:|    .:..|.:...|:.::|.|:..:
  Fly   278 ----SEPMARMYFIFYSLAMPLQIFPSCF----FGTDNEYWFGRLHYAAFSCNWHTQNRSFKRKM 334

  Fly   375 RMMLMRTNRGFRLDVSWFMQMSLPTLMAMVRTSGQYFLLL 414
            .:.:.::.:.........|::.|.|..:.::.:...|.::
  Fly   335 MLFVEQSLKKSTAVAGGMMRIHLDTFFSTLKGAYSLFTII 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 78/357 (22%)
Or59aNP_523821.1 7tm_6 64..368 CDD:251636 75/352 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465167
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.