DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or63a and Or56a

DIOPT Version :9

Sequence 1:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_523796.2 Gene:Or56a / 37269 FlyBaseID:FBgn0034473 Length:419 Species:Drosophila melanogaster


Alignment Length:397 Identity:80/397 - (20%)
Similarity:146/397 - (36%) Gaps:85/397 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 MLARYIHDIPRIGETA---GTALQ-FLTSIAKMWYFL----------FAHRQIYELLRKA--RCH 111
            ||||.......:.:.|   .||:| |..|||....::          .||..|..|:.:|  |..
  Fly    61 MLARVFRGYENLNDGATSYATAVQYFAVSIAMFNAYVQRDKVISLLRVAHSDIQNLMHEADNREM 125

  Fly   112 ELLQKCELFERMSDLPVIKEIRQQVESTMNRYWASTRRQILIYLYSCICITTNYFINSFVINLYR 176
            |||...:.:.|...|.:               |..:....|:....||               ||
  Fly   126 ELLVATQAYTRTITLLI---------------WIPSVIAGLMAYSDCI---------------YR 160

  Fly   177 YFTKPKGSYDIMLPLPSLYPAWEHKGLEFPYYHIQMYL--ETCSLYI-----------CGMCAVS 228
            ....||..:::        || ..:|.|.|....|::.  |.|..::           .|:.|:.
  Fly   161 SLFLPKSVFNV--------PA-VRRGEEHPILLFQLFPFGELCDNFVVGYLGPWYALGLGITAIP 216

  Fly   229 FDGVFIVLCLHSVGL-MRSLNQMVEQ-----ATSELVPPDRRVEYLRCCIYQYQRVANFATEVNN 287
            ....||...:..|.| ::.||:.||:     ..|:||  ..|:.......:|.|....|..|...
  Fly   217 LWHTFITCLMKYVNLKLQILNKRVEEMDITRLNSKLV--IGRLTASELTFWQMQLFKEFVKEQLR 279

  Fly   288 CFRHITFTQFLLS--------LFNWGLALFQMSVGLGNNSSITMIRMTMYLVAAGYQIVVYCYNG 344
            ..:.:...|:|:.        :|:..:.....::.:|..|.:....|.:||......:.:|.::.
  Fly   280 IRKFVQELQYLICVPVMADFIIFSVLICFLFFALTVGVPSKMDYFFMFIYLFVMAGILWIYHWHA 344

  Fly   345 QRFATASEEIANAFYQVRWYGESREFRHLIRMMLMRTNRGFRLDVSWFMQMSLPTLMAMVRTSGQ 409
            .......:|::.|::...||......:.::..|:|...|..::. :..:.::|.|.:.:.|.:..
  Fly   345 TLIVECHDELSLAYFSCGWYNFEMPLQKMLVFMMMHAQRPMKMR-ALLVDLNLRTFIDIGRGAYS 408

  Fly   410 YFLLLQN 416
            ||.||::
  Fly   409 YFNLLRS 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 72/374 (19%)
Or56aNP_523796.2 7tm_6 126..407 CDD:251636 58/322 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.