DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or63a and Or49b

DIOPT Version :9

Sequence 1:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster


Alignment Length:420 Identity:93/420 - (22%)
Similarity:151/420 - (35%) Gaps:101/420 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 QVLRIWTIVLSVSSLASLYGHWQMLARYI-------HDIPRIGETAGTALQFLTSIAK------M 91
            ::||.|         |.||.  :.|.||:       |...:|.....|. :.||.|.:      :
  Fly    13 KILRFW---------ALLYD--KNLRRYVCIGLASFHIFTQIVYMMSTN-EGLTGIIRNSYMLVL 65

  Fly    92 W-------YFLFAHRQIYELLRKARCHELLQKCELFERMSDL-----PVIKEIRQQVESTMNRYW 144
            |       |.|.|....|        ..|:||  |.|...||     ..|.||..||    |:..
  Fly    66 WINTVLRAYLLLADHDRY--------LALIQK--LTEAYYDLLNLNDSYISEILDQV----NKVG 116

  Fly   145 ASTRRQILIYLYSCICITTNYFINSFVINLYRYFTKPKGSYDIMLPLPSLYPAWEHKGL---EFP 206
            ....|..|.:          ..:.|....||     |..|.:.:||..|..|     ||   |.|
  Fly   117 KLMARGNLFF----------GMLTSMGFGLY-----PLSSSERVLPFGSKIP-----GLNEYESP 161

  Fly   207 YYHI----QMYLET--CSLYICGMCAVSFDGVFIVLCLHSVGLMRSLNQMVEQAT-----SELVP 260
            ||.:    ||.:..  |.:||      .:..:.:.|.:..:...::|...:.|..     .:..|
  Fly   162 YYEMWYIFQMLITPMGCCMYI------PYTSLIVGLIMFGIVRCKALQHRLRQVALKHPYGDRDP 220

  Fly   261 PDRRVEYLRCCIYQYQRVANFATEVNNCFRHITFTQFLLSLFNWG---LALFQMSVGLGNNSSIT 322
            .:.|.|.:.|..|| |.:..:...:|    .:|...||..|..:.   .||..|.:.:...|.:.
  Fly   221 RELREEIIACIRYQ-QSIIEYMDHIN----ELTTMMFLFELMAFSALLCALLFMLIIVSGTSQLI 280

  Fly   323 MIRMTMYLVAAGYQIVVYCYNGQRFATASEEIANAFYQVRWYGESREFRHLIRMMLMRTNRGFRL 387
            ::.|.:.::.|  ||:...:........:..:|.|.|:..|:......|..|..|:||..|...:
  Fly   281 IVCMYINMILA--QILALYWYANELREQNLAVATAAYETEWFTFDVPLRKNILFMMMRAQRPAAI 343

  Fly   388 DVSWFMQMSLPTLMAMVRTSGQYFLLLQNV 417
            .:.....::|.....::.|:..:|.:|:.|
  Fly   344 LLGNIRPITLELFQNLLNTTYTFFTVLKRV 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 79/366 (22%)
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 78/357 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465287
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.