DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or63a and Or45b

DIOPT Version :9

Sequence 1:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster


Alignment Length:342 Identity:72/342 - (21%)
Similarity:143/342 - (41%) Gaps:40/342 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 TSIAKMWYFLFAHRQIYELLRKARCHELLQKCELFERMSDLPVIKEIRQQVESTMNRYWASTRRQ 150
            |::.|:.:..:..:::.:|:.:.|.  |:.:.|..|         :.|::| :..:.|...||..
  Fly    84 TTLFKLGWMWWRRQEVADLMDRIRL--LIGEQEKRE---------DSRRKV-AQRSYYLMVTRCG 136

  Fly   151 ILIYLYSCICITTNYFINSFVINLYRYFTKPKGSYDIMLPLPSLYPAWEHKGLEFPYYHIQMYLE 215
            :|::...  .|||..|:   :.:|:..:.:....:...:|...|:..:.|:...||.:::   ..
  Fly   137 MLVFTLG--SITTGAFV---LRSLWEMWVRRHQEFKFDMPFRMLFHDFAHRMPWFPVFYL---YS 193

  Fly   216 TCSLYICGMCAVSFDGVFIVLCLHSVGLMRSLNQMVEQATSELVPPDRRVEYLRCCIYQYQRVAN 280
            |.|..:........||.|....|:...|:::|...::.|...:..|..| |...||    ||:|:
  Fly   194 TWSGQVTVYAFAGTDGFFFGFTLYMAFLLQALRYDIQDALKPIRDPSLR-ESKICC----QRLAD 253

  Fly   281 FATEVNNCFRHI----------TFTQFLLSLFNWGLALFQMSVGLGNNSSITMIRMTMYLVAAGY 335
            .....|...:.:          ||..|:.:    .|.:....:.:...|...:||..:|......
  Fly   254 IVDRHNEIEKIVKEFSGIMAAPTFVHFVSA----SLVIATSVIDILLYSGYNIIRYVVYTFTVSS 314

  Fly   336 QIVVYCYNGQRFATASEEIANAFYQVRWYGESREFRHLIRMMLMRTNRGFRLDVSWFMQMSLPTL 400
            .|.:|||.|...:|.|..:..|.|...||...||.|..:.::::|..|...:.|.:|.. |||..
  Fly   315 AIFLYCYGGTEMSTESLSLGEAAYSSAWYTWDRETRRRVFLIILRAQRPITVRVPFFAP-SLPVF 378

  Fly   401 MAMVRTSGQYFLLLQNV 417
            .::::.:|....|.:.:
  Fly   379 TSVIKFTGSIVALAKTI 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 70/331 (21%)
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 70/331 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435210
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.