DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or63a and Or45a

DIOPT Version :9

Sequence 1:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_523666.3 Gene:Or45a / 35958 FlyBaseID:FBgn0033404 Length:378 Species:Drosophila melanogaster


Alignment Length:403 Identity:99/403 - (24%)
Similarity:173/403 - (42%) Gaps:59/403 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VGFNLLDPSRCGQVLR--IWTIVLSVSSLASLYGH-WQMLA---RYIHDIPRIGETAGTALQFLT 86
            |||   |||.....|:  ||..:|    :.||..| |.|:.   :.:.|:.|:.:.....:|...
  Fly    16 VGF---DPSTPQLSLKHPIWAGIL----ILSLISHNWPMVVYALQDLSDLTRLTDNFAVFMQGSQ 73

  Fly    87 SIAKMWYFLFAHRQIYELLRKARCHELLQKC-------ELFERMSDLPVIKEIRQQVESTMNRYW 144
            |..|....:...|:|..|:.  |.|:|.|..       |..||              |:.::||.
  Fly    74 STFKFLVMMAKRRRIGSLIH--RLHKLNQAASATPNHLEKIER--------------ENQLDRYV 122

  Fly   145 ASTRRQILIYLYSCICITTNYFINSFVINLYRYFTKPKGSYDIMLPLPSLYPAWEHKGLEFPYYH 209
            |.:.|..   .|..||.:.   |...::.|:.|.  ..|.:....|:...:...|.|    |:::
  Fly   123 ARSFRNA---AYGVICASA---IAPMLLGLWGYV--ETGVFTPTTPMEFNFWLDERK----PHFY 175

  Fly   210 IQMYL-ETCSLYICGMCAVSFDGVFIVLCLHSVGLMRSLNQMVEQATSELVPPDRRVEYLRCCIY 273
            ..:|: ....:......|::.|.:|..| .|:|.:...|.::|.: ..:|...|.|   |...:.
  Fly   176 WPIYVWGVLGVAAAAWLAIATDTLFSWL-THNVVIQFQLLELVLE-EKDLNGGDSR---LTGFVS 235

  Fly   274 QYQRVANFATEVNNCFRHITFTQFLLSLFNWGLALFQMSVGLGNNSSITMIRMTMYLVAAGYQIV 338
            :::...:.|.|:::.|..|.|.:::||.....:..|:.|  ....|:....|.| :|||...|:.
  Fly   236 RHRIALDLAKELSSIFGEIVFVKYMLSYLQLCMLAFRFS--RSGWSAQVPFRAT-FLVAIIIQLS 297

  Fly   339 VYCYNGQRFATASEEIANAFY-QVRWYGESREFRHLIRMMLMRTNRGFRLDVSWFMQMSLPTLMA 402
            .|||.|:.....|..||.|.| |:.|...:.:.|.|.:|::||..|..:: ..:...:.||.|:.
  Fly   298 SYCYGGEYIKQQSLAIAQAVYGQINWPEMTPKKRRLWQMVIMRAQRPAKI-FGFMFVVDLPLLLW 361

  Fly   403 MVRTSGQYFLLLQ 415
            ::||:|.:..:|:
  Fly   362 VIRTAGSFLAMLR 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 80/340 (24%)
Or45aNP_523666.3 7tm_6 64..367 CDD:251636 80/339 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465068
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.