DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or63a and Or43a

DIOPT Version :9

Sequence 1:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_523647.2 Gene:Or43a / 35644 FlyBaseID:FBgn0026389 Length:376 Species:Drosophila melanogaster


Alignment Length:428 Identity:79/428 - (18%)
Similarity:149/428 - (34%) Gaps:95/428 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VGFNLLDPSRCGQVLRIWTIVLSVSSLASLY----GHWQMLARYIHDIPRIGETAGTALQFL--- 85
            ||.|          :|:|      ..||.||    ..|:..| ::..:     ||...:||:   
  Fly     9 VGIN----------VRMW------RHLAVLYPTPGSSWRKFA-FVLPV-----TAMNLMQFVYLL 51

  Fly    86 --------------------TSIAKMWYFLFAHRQIYELLRKARC--HELLQKCELFERMSDLPV 128
                                .::.:.|..:...||..|.|.:...  |.:|...:.:.|    .:
  Fly    52 RMWGDLPAFILNMFFFSAIFNALMRTWLVIIKRRQFEEFLGQLATLFHSILDSTDEWGR----GI 112

  Fly   129 IKEIRQQVESTMNRYWASTRRQILIYLYSCICITTNYFINSFVINLYRYFTKPKGSYDIMLPLPS 193
            ::...::.            |.:.|...|...:.   .:.:.|..|:|    .:.::...|.||.
  Fly   113 LRRAEREA------------RNLAILNLSASFLD---IVGALVSPLFR----EERAHPFGLALPG 158

  Fly   194 LYPAWEHKGLEFPYYHIQMYLETCSLYICGMCAVSFDGVFIVLCLHSVGLMRSLNQMVEQATSEL 258
            :      .....|.|.:....:..:..:..|..:.|..:|..|.:....:::.|...:.|...|.
  Fly   159 V------SMTSSPVYEVIYLAQLPTPLLLSMMYMPFVSLFAGLAIFGKAMLQILVHRLGQIGGEE 217

  Fly   259 VPPDRRVEYLRCCIYQYQRVANFATEVNNCFRHIT------FTQFLLSLFNWGLALFQMSVGLGN 317
            ...:.|.:.|..||..:.:|..:..::|....:|.      |...:.||      ||.:::   .
  Fly   218 QSEEERFQRLASCIAYHTQVMRYVWQLNKLVANIVAVEAIIFGSIICSL------LFCLNI---I 273

  Fly   318 NSSITMIRMTMYLVAAGYQIVVYCYNGQRFATASEEIANAFYQVRWYGESREFRHLIRMMLMRTN 382
            .|...:|.:.||::...|.:..|..........:..:|.|.|.|.||.....||..:.:.||:|.
  Fly   274 TSPTQVISIVMYILTMLYVLFTYYNRANEICLENNRVAEAVYNVPWYEAGTRFRKTLLIFLMQTQ 338

  Fly   383 RGFRLDVSWFMQMSLPTLMAMVRTSGQYFLLLQNVNQK 420
            ....:.|.....|:|....:::..|..||.:|:.|..|
  Fly   339 HPMEIRVGNVYPMTLAMFQSLLNASYSYFTMLRGVTGK 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 62/362 (17%)
Or43aNP_523647.2 7tm_6 56..364 CDD:251636 58/345 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465288
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.