DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or63a and Or33c

DIOPT Version :9

Sequence 1:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster


Alignment Length:423 Identity:91/423 - (21%)
Similarity:158/423 - (37%) Gaps:107/423 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 VSSLASLYGHWQMLARYIHDIPRIGETAGTALQ----FLTSIAKMWYFLFAHRQIYELLRKARCH 111
            :.|| |.|..:.:..|.:  :|...:.:...:|    .|..:..:|:.|  |..::.||      
  Fly     4 IDSL-SFYRPFWICMRLL--VPTFFKDSSRPVQLYVVLLHILVTLWFPL--HLLLHLLL------ 57

  Fly   112 ELLQKCELFERMS-----------------DLPVIKEIRQQVE--------STMNRYW-----AS 146
             |....|.|:.::                 .||.|.||...:|        ...:||:     ..
  Fly    58 -LPSTAEFFKNLTMSLTCVACSLKHVAHLYHLPQIVEIESLIEQLDTFIASEQEHRYYRDHVHCH 121

  Fly   147 TRRQILIYLYSCICITTNYFINSFVINLYRYFTKP-KGSYDIMLPLPSLYPAWEHKGLEFPY-YH 209
            .||     ...|:.|:   |...:.:.|:..|.:. .|::::      ||||:      ||: ..
  Fly   122 ARR-----FTRCLYIS---FGMIYALFLFGVFVQVISGNWEL------LYPAY------FPFDLE 166

  Fly   210 IQMYLETCSL--YICGMCAVSFDGVF------IVLCL-----HSVGL-MRSLNQMVEQATSELVP 260
            ...:|...:|  .:..|....|.|:.      :.|||     |...: |..|....::.   :|.
  Fly   167 SNRFLGAVALGYQVFSMLVEGFQGLGNDTYTPLTLCLLAGHVHLWSIRMGQLGYFDDET---VVN 228

  Fly   261 PDRRVEYLRCCIYQYQRVANFATEVNNCFRHITFTQFLLSLFNWGLAL----FQMSVGLGNNSSI 321
            ..|.::|    |.|::.:..|...|:   |.|:..| |:.|...|..|    ..|...:|:.   
  Fly   229 HQRLLDY----IEQHKLLVRFHNLVS---RTISEVQ-LVQLGGCGATLCIIVSYMLFFVGDT--- 282

  Fly   322 TMIRMTMYLVAAG---YQIVVYCYNGQRFATASEEIANAFYQVRWYGESREFRH--LIRMMLMRT 381
              |.:..|||..|   .|:...||.....|...|.:..|.:..|||.:||:.|.  ||...|...
  Fly   283 --ISLVYYLVFFGVVCVQLFPSCYFASEVAEELERLPYAIFSSRWYDQSRDHRFDLLIFTQLTLG 345

  Fly   382 NRGFRLDVSWFMQMSLPTLMAMVRTSGQYFLLL 414
            |||:.:.....::::|....|.::.:...|.::
  Fly   346 NRGWIIKAGGLIELNLNAFFATLKMAYSLFAVV 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 84/390 (22%)
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 76/347 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465171
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.