DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or63a and Or33b

DIOPT Version :9

Sequence 1:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_523554.1 Gene:Or33b / 34602 FlyBaseID:FBgn0026391 Length:379 Species:Drosophila melanogaster


Alignment Length:382 Identity:69/382 - (18%)
Similarity:135/382 - (35%) Gaps:92/382 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 LTSIAKMWY------FLFAHRQIYELLR----KARCHELLQKCELFE-RMSDLPVI----KEIRQ 134
            :|....:||      .||..|.:.::.:    .|.|.....|...|. ::|::..|    ||:.|
  Fly    40 ITIFVTIWYPIHLILGLFMERSLGDVCKGLPITAACFFASFKFICFRFKLSEIKEIEILFKELDQ 104

  Fly   135 QVEST-----MNRYWASTRRQILIYLYSCICITTNYFINSFVINLYRYFTKPKGSYDI--MLPLP 192
            :..|.     .|:   :|||:            .|:...||::           :|.:  :..:.
  Fly   105 RALSREECEFFNQ---NTRRE------------ANFIWKSFIV-----------AYGLSNISAIA 143

  Fly   193 S---------LYPAWEHKGLEFPYYHIQ----MYLETCSLYICGMCAVSFDGV---------FIV 235
            |         |||||      || |.:|    ::..:.:..|.|:.......:         |.|
  Fly   144 SVLFGGGHKLLYPAW------FP-YDVQATELIFWLSVTYQIAGVSLAILQNLANDSYPPMTFCV 201

  Fly   236 LCLHSVGLMRSLNQMVEQATSELVPPDRRVEYLRC-----CIYQYQRVANFATEVNNCFRHITFT 295
            :..| |.|:......:.|...|.:       ||..     .|..::::......:.:........
  Fly   202 VAGH-VRLLAMRLSRIGQGPEETI-------YLTGKQLIESIEDHRKLMKIVELLRSTMNISQLG 258

  Fly   296 QFLLSLFNWGLALFQMSVGLGNNSSITMIRMTMYLVAAGYQIVVYCYNGQRFATASEEIANAFYQ 360
            ||:.|..|..:.|..:.....||.:||.  ..:|.::...::...||.|...:....::..|.|.
  Fly   259 QFISSGVNISITLVNILFFADNNFAITY--YGVYFLSMVLELFPCCYYGTLISVEMNQLTYAIYS 321

  Fly   361 VRWYGESREFRHLIRMMLMRTNRGFRLDVSWFMQMSLPTLMAMVRTSGQYFLLLQNV 417
            ..|...:|.:..::.:.:..|....::.....:.:.:....|.||.:..:|.|..::
  Fly   322 SNWMSMNRSYSRILLIFMQLTLAEVQIKAGGMIGIGMNAFFATVRLAYSFFTLAMSL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 67/371 (18%)
Or33bNP_523554.1 7tm_6 61..369 CDD:251636 61/350 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465169
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.