DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or63a and Or33a

DIOPT Version :9

Sequence 1:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_523553.1 Gene:Or33a / 34601 FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster


Alignment Length:252 Identity:46/252 - (18%)
Similarity:80/252 - (31%) Gaps:63/252 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 LYPAWEHKGLEFPY--------YHIQMYLET--CSLYI-----------CGMCAVSFDGVFIVLC 237
            :|..|      |||        |.|....:.  .||.|           ...|.||.....:::.
  Fly   152 MYLGW------FPYDFQATAAIYWISFSYQAIGSSLLILENLANDSYPPITFCVVSGHVRLLIMR 210

  Fly   238 L----HSVGLMRSLNQMVEQATSELVP--PDRR-----VEYLRCCIYQYQRVANFATEVNNCFRH 291
            |    |.|.|..|.|      |.:|:.  .|.|     :..||..::..|               
  Fly   211 LSRIGHDVKLSSSEN------TRKLIEGIQDHRKLMKIIRLLRSTLHLSQ--------------- 254

  Fly   292 ITFTQFLLSLFNWGLALFQMSVGLGNNSSITMIRMTMYLVAAGYQIVVYCYNGQRFATASEEIAN 356
              ..|||.|..|..:.|..:.....||  ..|:...::..|...::...||.|.......:::..
  Fly   255 --LGQFLSSGINISITLINILFFAENN--FAMLYYAVFFAAMLIELFPSCYYGILMTMEFDKLPY 315

  Fly   357 AFYQVRWYGESREFRHLIRMMLMRTNRGFRLDVSWFMQMSLPTLMAMVRTSGQYFLL 413
            |.:...|....:.:...:.:::..|.....:.....:.:.:....|.||.:..::.|
  Fly   316 AIFSSNWLKMDKRYNRSLIILMQLTLVPVNIKAGGIVGIDMSAFFATVRMAYSFYTL 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 45/245 (18%)
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 45/245 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465170
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.