DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or63a and Or23a

DIOPT Version :9

Sequence 1:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_523458.3 Gene:Or23a / 33450 FlyBaseID:FBgn0026395 Length:379 Species:Drosophila melanogaster


Alignment Length:418 Identity:78/418 - (18%)
Similarity:147/418 - (35%) Gaps:107/418 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LRIWTIVLSVSSLASLYGHWQ------------MLARYIHDIPRIGETAGTALQFLTSIAKMWYF 94
            |..|.|..::......|..|.            ||.|.::......|...:....:||::.:..|
  Fly    16 LNAWRICGALDLSEGRYWSWSMLLCILVYLPTPMLLRGVYSFEDPVENNFSLSLTVTSLSNLMKF 80

  Fly    95 LFAHRQIYELLRKARCHELLQKCELFERMSDLPVIKEIRQQV--ESTMNRYWASTRRQILIYLYS 157
                           |..:.|..::.|..|   :|.::..:|  ||...|:...|..  |:.:..
  Fly    81 ---------------CMYVAQLTKMVEVQS---LIGQLDARVSGESQSERHRNMTEH--LLRMSK 125

  Fly   158 CICITTNYFINSFVINLYRYFTKPKGSYDIMLPLPSLYP-AWEHKGLEFPYYHIQMYLETCSLYI 221
            ...||   :...|:|....:..:.    ::.||:|..:| .|::.                    
  Fly   126 LFQIT---YAVVFIIAAVPFVFET----ELSLPMPMWFPFDWKNS-------------------- 163

  Fly   222 CGMCAVSFDGVFIVLCLHSVGLMRSLNQMVEQATSELVPPDRRVEYL---RCCI---------YQ 274
                .|::.|   .|....:|.   :.|:::...::..||  .|.||   :|.:         |.
  Fly   164 ----MVAYIG---ALVFQEIGY---VFQIMQCFAADSFPP--LVLYLISEQCQLLILRISEIGYG 216

  Fly   275 YQRVANFATEVNNCFRHITFTQFLL----SLFNWGLALFQMSVGLGNNSSITMIRMTMYLVAAGY 335
            |:.:.....::.||.|.......||    ||.::.:.:..|.:|:  |.:||:..:..| |...|
  Fly   217 YKTLEENEQDLVNCIRDQNALYRLLDVTKSLVSYPMMVQFMVIGI--NIAITLFVLIFY-VETLY 278

  Fly   336 QIVVY--------------CYNGQRFATASEEIANAFYQVRWYGESREFRHLIRMMLMRTNRGFR 386
            ..:.|              ||.|.....:..|:..|.:...|..:|..:|..:.::..||.|...
  Fly   279 DRIYYLCFLLGITVQTYPLCYYGTMVQESFAELHYAVFCSNWVDQSASYRGHMLILAERTKRMQL 343

  Fly   387 LDVSWFMQMSLPTLMAMVRTSGQYFLLL 414
            |.....:.:.|.|.:|..:.:..:|.|:
  Fly   344 LLAGNLVPIHLSTYVACWKGAYSFFTLM 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 68/364 (19%)
Or23aNP_523458.3 7tm_6 59..365 CDD:251636 68/367 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465168
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.