DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or63a and Or22c

DIOPT Version :9

Sequence 1:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_523454.2 Gene:Or22c / 33381 FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster


Alignment Length:347 Identity:86/347 - (24%)
Similarity:154/347 - (44%) Gaps:53/347 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 IAKMWYFLFAHRQIYELLRKARCHELLQKCELFERMSDLPVIKEIRQQVESTMNRYWASTRRQIL 152
            :.|:|.|..::|:..||:::.|.                 ::.|.|:|....|....|:|..::.
  Fly    87 VLKLWVFFRSNRRWAELVQRLRA-----------------ILWESRRQEAQRMLVGLATTANRLS 134

  Fly   153 IYLYSCICITTNYF-INSFVINLYRYFTKPKGS----YDIMLPLPSLYPAWEHKGLEFPYYHIQM 212
            :.|.|....|...| :...::.|||:..:..|.    ::|:||..::.|.      .||..::  
  Fly   135 LLLLSSGTATNAAFTLQPLIMGLYRWIVQLPGQTELPFNIILPSFAVQPG------VFPLTYV-- 191

  Fly   213 YLETCSLYICGMCAV---SF-DGVFIVLCLHSVGLMRSLNQMVEQATSEL-------VPPDRRVE 266
             |.|.|    |.|.|   || ||.||..||:..|..|.:.|.:.:..::|       ...:...|
  Fly   192 -LLTAS----GACTVFAFSFVDGFFICSCLYICGAFRLVQQDIRRIFADLHGDSVDVFTEEMNAE 251

  Fly   267 Y---LRCCIYQYQRVANFATEVNNCFRHITFTQFLLSLFNWGLALFQMSVGLGNNSSITMIRMTM 328
            .   |...:.::..:.:|.|::...|..|....||.:.|.....:..:.:   |.||::.:....
  Fly   252 VRHRLAQVVERHNAIIDFCTDLTRQFTVIVLMHFLSAAFVLCSTILDIML---NTSSLSGLTYIC 313

  Fly   329 YLVAAGYQIVVYCYNGQRFATASEEIANAFYQVRWYGESREFRHLIRMMLMRTNRGFRLDVSWFM 393
            |::||..|:.:||:.|...:.:|..:|:..|.:.||......|.:|.|:|.|:.|...:.|.:|.
  Fly   314 YIIAALTQLFLYCFGGNHVSESSAAVADVLYDMEWYKCDARTRKVILMILRRSQRAKTIAVPFFT 378

  Fly   394 QMSLPTLMAMVRTSGQYFLLLQ 415
            . |||.|.:::.|:|.|..||:
  Fly   379 P-SLPALRSILSTAGSYITLLK 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 82/338 (24%)
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 82/338 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435212
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.