DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or63a and Or22b

DIOPT Version :9

Sequence 1:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster


Alignment Length:376 Identity:70/376 - (18%)
Similarity:134/376 - (35%) Gaps:80/376 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 KMWYFLFAHRQIYELLRKARCHELLQKCELFERMSDLPVIKEIRQQVESTMNRYWASTRRQILIY 154
            |:| ..|....|:.||..:...|.:|:.:.|.       ..|....::..:|.|.:|.:..:.:.
  Fly    49 KLW-STFVTLLIFILLPISVSVEYIQRFKTFS-------AGEFLSSIQIGVNMYGSSFKSYLTMM 105

  Fly   155 LYS---------------CIC------------------ITTNYFINSFVINLYRYFTKPKGSYD 186
            .|.               |:|                  |..:....||:|:.:..|...:    
  Fly   106 GYKKRQEAKMSLDELDKRCVCDEERTIVHRHVALGNFCYIFYHIAYTSFLISNFLSFIMKR---- 166

  Fly   187 IMLPLPSLYPAWEHKGLEFPYYHIQMYLETCSLYICGMCAVSFDG--VFIVLC-----LHSVGLM 244
                    ..||.   :.|||...:.     ..||..:..|...|  ||:.||     |.|:.:.
  Fly   167 --------IHAWR---MYFPYVDPEK-----QFYISSIAEVILRGWAVFMDLCTDVCPLISMVIA 215

  Fly   245 RS----LNQMVEQATSELVPPDRRVEYLR---CCIYQYQRVANFATEVNNCFRHITFTQFLLSLF 302
            |.    |.|.:....||  |.....|||:   .|:..::.:.::...:.:.|....|.||||...
  Fly   216 RCHITLLKQRLRNLRSE--PGRTEDEYLKELADCVRDHRLILDYVDALRSVFSGTIFVQFLLIGI 278

  Fly   303 NWGLALFQMSVGLGNNSSITMIRMTMYLVAAGYQIVVYCYNGQRFATASEEIANAFYQVRWYGES 367
            ..||::..:   :..::..|.:.:.:::.....|...:||.........:|:|::.:|..|....
  Fly   279 VLGLSMINI---MFFSTLSTGVAVVLFMSCVSMQTFPFCYLCNMIMDDCQEMADSLFQSDWTSAD 340

  Fly   368 REFRHLIRMMLMRTNRGFRLDVSWFMQMSLPTLMAMVRTSGQYFLLLQNVN 418
            |.::..:...|....:...|.......:|:.|.:.||:.:.....:::..|
  Fly   341 RRYKSTLVYFLHNLQQPIILTAGGVFPISMQTNLNMVKLAFTVVTIVKQFN 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 69/364 (19%)
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 60/324 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465183
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.