DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or63a and Or13a

DIOPT Version :9

Sequence 1:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_523359.2 Gene:Or13a / 32562 FlyBaseID:FBgn0030715 Length:418 Species:Drosophila melanogaster


Alignment Length:427 Identity:94/427 - (22%)
Similarity:164/427 - (38%) Gaps:101/427 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RIWTIVLSVSSLASLYGHWQMLARYIHDIPRIGETAGTALQFL---------------TSIAKMW 92
            |.|.   |.|.||:.|..|   |.|:  |..:|.|......||               |:...:.
  Fly    32 RPWR---SQSLLATAYIVW---AWYV--IASVGITISYQTAFLLNNLSDIIITTENCCTTFMGVL 88

  Fly    93 YFLFAHRQIYELLRKARCHELLQKCELFERMSDLPVIKEIRQQVESTMNRYWASTRRQILIY--- 154
            .|:   |.|:..|.:.:..:|:   |.|.....:|         .|:.|...|..||:::.:   
  Fly    89 NFV---RLIHLRLNQRKFRQLI---ENFSYEIWIP---------NSSKNNVAAECRRRMVTFSIM 138

  Fly   155 --LYSCICITTNYFINSFVINLYRYFTKPKGSYDIMLPLPSLY--PAWEHKGLEFPYYHIQMYLE 215
              |.:|:.|            :|           .:|||..::  ||::.:...|||..|..|..
  Fly   139 TSLLACLII------------MY-----------CVLPLVEIFFGPAFDAQNKPFPYKMIFPYDA 180

  Fly   216 TCS--LYICGMCAVSFDGVFIVLCL------------HSVGLMRSLNQMV----EQATSELVPPD 262
            ..|  .|:......|:.|:.:|..|            ::.|....|:|.:    ..:.:||. ..
  Fly   181 QSSWIRYVMTYIFTSYAGICVVTTLFAEDTILGFFITYTCGQFHLLHQRIAGLFAGSNAELA-ES 244

  Fly   263 RRVEYLRCCIYQYQRVANFATEVNNCFRHITFTQFLLSLFNWGLALFQMSVGLGNNSSI-TMIRM 326
            .::|.|:..:.::..:.:||..:.:.|..|.....::|.....:..||  :..|.|..| ..::.
  Fly   245 IQLERLKRIVEKHNNIISFAKRLEDFFNPILLANLMISSVLICMVGFQ--IVTGKNMFIGDYVKF 307

  Fly   327 TMYLVAAGYQIVVYCYNGQRFATASEEIANAFYQVRWYGESR-----------EFRHLIRMMLMR 380
            .:|:.:|..|:.|.|.||......|...|...|:.:|.|..|           ..|:.|..|::.
  Fly   308 IIYISSALSQLYVLCENGDALIKQSTLTAQILYECQWEGSDRIEIQSFTPTTKRIRNQIWFMILC 372

  Fly   381 TNRGFRLDVSWFMQMSLPTLMAMVRTSGQYFLLLQNV 417
            :.:..|:....|..:||.:..|::.||..||.||::|
  Fly   373 SQQPVRITAFKFSTLSLQSFTAILSTSISYFTLLRSV 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 76/383 (20%)
Or13aNP_523359.2 7tm_6 78..399 CDD:251636 72/361 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465369
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.