DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or63a and Or10a

DIOPT Version :9

Sequence 1:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster


Alignment Length:371 Identity:81/371 - (21%)
Similarity:149/371 - (40%) Gaps:79/371 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 AGTA----------LQFLTSIAKMWYFLFAHRQIYELLRKARCHELLQKCELFERMSDLPVIKEI 132
            |||:          |:|...::.||..|                    :..||:...:.|..::|
  Fly    81 AGTSAVTLLKMFLMLRFRQDLSIMWNRL--------------------RGLLFDPNWERPEQRDI 125

  Fly   133 RQQVESTMNR--YWASTRRQILIYLYSCICITTNYFINSFVINLYRY----------FTKPKGSY 185
            |.:..:...|  :|     .:....::|    |.|.:...:|.:..|          ||    .:
  Fly   126 RLKHSAMAARINFW-----PLSAGFFTC----TTYNLKPILIAMILYLQNRYEDFVWFT----PF 177

  Fly   186 DIMLPLPSL-YPAWEHKGLEFPYYHIQM-YLETCSLYICGMCAVSFDGVFIVLCLHSVGLMRSLN 248
            ::.:|...| ||.       ||..:|.: |....::::.|.|    ||.:...|.|...|...|.
  Fly   178 NMTMPKVLLNYPF-------FPLTYIFIAYTGYVTIFMFGGC----DGFYFEFCAHLSALFEVLQ 231

  Fly   249 QMVEQATS------ELVPPDRRV--EYLRCCIYQYQRVANFATEVNNCFRHITFTQFLLSLFNWG 305
            ..:|....      ||.|....:  :.:|..|.::..:.:......:.:..||...|:.:....|
  Fly   232 AEIESMFRPYTDHLELSPVQLYILEQKMRSVIIRHNAIIDLTRFFRDRYTIITLAHFVSAAMVIG 296

  Fly   306 LALFQMSVGLGNNSSITMIRMTMYLVAAGYQIVVYCYNGQRFATASEEIANAFYQVRWYGESREF 370
            .::..: :.||||....|:.:. |.|||..|::||||.|...|.:|..:..|.:...|.....:.
  Fly   297 FSMVNL-LTLGNNGLGAMLYVA-YTVAALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQ 359

  Fly   371 RHLIRMMLMRTNRGFRLDVSWFMQMSLPTLMAMVRTSGQYFLLLQN 416
            |.|::::::|:.|...:.|.:| ..||.|..|:::|||....|:::
  Fly   360 RRLVQLLILRSQRPVSMAVPFF-SPSLATFAAILQTSGSIIALVKS 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 78/361 (22%)
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 78/361 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435211
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.