DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or63a and Or9a

DIOPT Version :9

Sequence 1:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster


Alignment Length:419 Identity:87/419 - (20%)
Similarity:169/419 - (40%) Gaps:58/419 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RSIREMIRLSYTVGFNLLDPSRCGQVLRIWTIVLSVSSL------ASLYGHWQMLARYIHDIPRI 74
            :|:|..|.:...:|.:|..|:....  |.|...:::..|      ..|..|     .||..:..:
  Fly    15 QSLRVQILVYRCMGIDLWSPTMAND--RPWLTFVTMGPLFLFMVPMFLAAH-----EYITQVSLL 72

  Fly    75 GETAGTALQFLTSIAKMWYFLFAHRQIYELLRKARCHELLQKCELFERMSDLPVIKEIRQQVEST 139
            .:|.|:....:.::.|...|.:..::...|:...|.  :|.| |: |...|...|.|:..|.:..
  Fly    73 SDTLGSTFASMLTLVKFLLFCYHRKEFVGLIYHIRA--ILAK-EI-EVWPDAREIIEVENQSDQM 133

  Fly   140 MNRYWASTRRQILIYLYSCICITTNYFINSFVINLYRYFTKPKGSYDIMLPLPSLYPAWEHKGLE 204
            ::..:  ||...|..:::.:.......::|.           :|. :|.|.||       |.|: 
  Fly   134 LSLTY--TRCFGLAGIFAALKPFVGIILSSI-----------RGD-EIHLELP-------HNGV- 176

  Fly   205 FPYYHIQMYLETCSLYICGMCAVSFDGVFIVLCLHSVGLMRSLN----------QMVEQATSELV 259
            :| |.:|:.:.....|:..:.| |:..|.:.||:.|:....:.|          :|:....   |
  Fly   177 YP-YDLQVVMFYVPTYLWNVMA-SYSAVTMALCVDSLLFFFTYNVCAIFKIAKHRMIHLPA---V 236

  Fly   260 PPDRRVEYLRCCIYQYQRVANFATEVNNCFRHITFTQFLLSLFNWGLALFQMSVGLGNNSSITMI 324
            .....:|.|...:..:|:....|..:.:.:|.:.|.||.||........||::....|..|:..|
  Fly   237 GGKEELEGLVQVLLLHQKGLQIADHIADKYRPLIFLQFFLSALQICFIGFQVADLFPNPQSLYFI 301

  Fly   325 RMTMYLVAAGYQIVVYCYNGQRFATASEEIANAFYQVRWYGESREFRHLIRMMLMRTNRGFRLDV 389
            .....|:.|   :.:|...|:...:||.:..|..|:..|...|...:..:.:..||..|..::. 
  Fly   302 AFVGSLLIA---LFIYSKCGENIKSASLDFGNGLYETNWTDFSPPTKRALLIAAMRAQRPCQMK- 362

  Fly   390 SWFMQMSLPTLMAMVRTSGQYFLLLQNVN 418
            .:|.:.|:.|...:||::..|.::|::.|
  Fly   363 GYFFEASMATFSTIVRSAVSYIMMLRSFN 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 71/341 (21%)
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 71/347 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465066
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.