DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or63a and Or82a

DIOPT Version :9

Sequence 1:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_730794.1 Gene:Or82a / 318778 FlyBaseID:FBgn0041621 Length:385 Species:Drosophila melanogaster


Alignment Length:393 Identity:65/393 - (16%)
Similarity:158/393 - (40%) Gaps:68/393 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 VSSLASLYGHWQMLARYI----HDIPRIGETAGTALQFLTSIAKMWYFLFAHRQIYELLRKARCH 111
            :|||..:......|..|:    :|:.::..........:.::.|:..||...:..:|::.:.|  
  Fly    34 ISSLIFVISAQYPLISYVAYNRNDMEKVTACLSVVFTNMLTVIKISTFLANRKDFWEMIHRFR-- 96

  Fly   112 ELLQKCELFERMSDLPVIKEIRQQVESTMNRY-----WASTRRQILIYLYSCICI----TTNYFI 167
                               ::.:|..|.:.||     :.:...::..:|....|:    |..||:
  Fly    97 -------------------KMHEQSASHIPRYREGLDYVAEANKLASFLGRAYCVSCGLTGLYFM 142

  Fly   168 NSFVINLYRYFTKPKG-------SYDIMLPLPSLYPAWEHKGLEFPYYHIQMYLETCSLY----- 220
            ...::.:        |       :.|..||:|..:|   ...||.|.|      |.|.||     
  Fly   143 LGPIVKI--------GVCRWHGTTCDKELPMPMKFP---FNDLESPGY------EVCFLYTVLVT 190

  Fly   221 -ICGMCAVSFDGVFIVLCLHSVGLMRSLNQMVEQATSELVPPDRRVEYLRCCIYQYQRVANFATE 284
             :....|.:.||:||...::.....::|.:.:|........||.::. |:..:..:..:.:.:.:
  Fly   191 VVVVAYASAVDGLFISFAINLRAHFQTLQRQIENWEFPSSEPDTQIR-LKSIVEYHVLLLSLSRK 254

  Fly   285 VNNCFRHITFTQFLLSLFNWGLALFQMSVGLGNNSSITMIRMTMYLVAAGYQIVVYCYNGQRFAT 349
            :.:.:......||:::....|:.::|:...:  :|.:.::....:..:...|:.:|||.|:....
  Fly   255 LRSIYTPTVMGQFVITSLQVGVIIYQLVTNM--DSVMDLLLYASFFGSIMLQLFIYCYGGEIIKA 317

  Fly   350 ASEEIANAFYQVRWYGESREFRHLIRMMLMRTNRGFRLDVSWFMQMSLPTLMAMVRTSGQYFLLL 414
            .|.::..|.....|:..|.:.|..:.::::::.:...:...:|: .||...:.:.||:.....|:
  Fly   318 ESLQVDTAVRLSNWHLASPKTRTSLSLIILQSQKEVLIRAGFFV-ASLANFVGICRTALSLITLI 381

  Fly   415 QNV 417
            :::
  Fly   382 KSI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 58/353 (16%)
Or82aNP_730794.1 7tm_6 65..374 CDD:251636 57/350 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465067
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.