DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or63a and Or2a

DIOPT Version :9

Sequence 1:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster


Alignment Length:441 Identity:87/441 - (19%)
Similarity:154/441 - (34%) Gaps:124/441 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IREMIRLSYTVGFNLLDPSRCGQVLRIWTIVLSVSSLASLYGHWQMLARYIHDIPRIGETAGTAL 82
            :..::.:.|::..||           :.|::..:|          :|||.:......|......:
  Fly    33 VSSLLYVVYSITVNL-----------VVTVLFPLS----------LLARLLFTTNMAGLCENLTI 76

  Fly    83 QFLTSIAKMWYFLFAHRQIYELLRKARCHELLQKCELFER----MSDLPVIKEIRQQVESTMNRY 143
            .....:|.:   .||:  :| ::|| :.||:.....|.:.    :.|...|..:|::|......:
  Fly    77 TITDIVANL---KFAN--VY-MVRK-QLHEIRSLLRLMDARARLVGDPEEISALRKEVNIAQGTF 134

  Fly   144 WASTRRQILIYLYSCICITTNYFINSFVINLYRYFTKPKGSYDIMLPLPSLYPAWEHKGLEF--- 205
              .|...|.::..:..|:              |...:|....        |||||  .|:::   
  Fly   135 --RTFASIFVFGTTLSCV--------------RVVVRPDREL--------LYPAW--FGVDWMHS 173

  Fly   206 --PYYHIQMY---------LETCSLYICGMCAVSFDGVFIVLCLHSVGLMRSLNQMV-------- 251
              .|..|.:|         ::.|:       :.|:...|  ||| ..|.||:|...|        
  Fly   174 TRNYVLINIYQLFGLIVQAIQNCA-------SDSYPPAF--LCL-LTGHMRALELRVRRIGCRTE 228

  Fly   252 ------------EQATSELVPPDRRVEYLRCCIYQYQRVANFATEVNNCFRHITFTQFLLSLFNW 304
                        |:...||:.          ||....||......:..........||:.|    
  Fly   229 KSNKGQTYEAWREEVYQELIE----------CIRDLARVHRLREIIQRVLSVPCMAQFVCS---- 279

  Fly   305 GLALFQMSVGL------GNNSSITMIRMTMYLVAAGYQIVVYCYNGQRFATASEEIANAFYQVRW 363
              |..|.:|.:      .::....||...::..|...::.|.||.|.|..|.||.:.:|||...|
  Fly   280 --AAVQCTVAMHFLYVADDHDHTAMIISIVFFSAVTLEVFVICYFGDRMRTQSEALCDAFYDCNW 342

  Fly   364 YGESREFRHLIRMMLMRTNRGFRLDVSWFMQMSLPTLMAMVRTSGQYFLLL 414
            ..:..:|:..:...|.||.|...:....::.:||.|...::|.:...|.||
  Fly   343 IEQLPKFKRELLFTLARTQRPSLIYAGNYIALSLETFEQVMRFTYSVFTLL 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 75/375 (20%)
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 76/379 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465174
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.