DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or63a and Or69a

DIOPT Version :9

Sequence 1:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster


Alignment Length:442 Identity:96/442 - (21%)
Similarity:171/442 - (38%) Gaps:94/442 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EAAELKRRNY---RSIREMIRLSYTVGFNLLDPSRCGQVLRIWTIVLSVSSLASLYGHWQMLARY 67
            :||:|.|..:   ||:.....|:..:.|.|      |.|..::..:..|     :||       |
  Fly    15 QAAQLPRYTWNGRRSLEVKRNLAKRIIFWL------GAVNLVYHNIGCV-----MYG-------Y 61

  Fly    68 IHDIPRIGETAG--TALQFLTSIAKMWYF-LFAHRQIYELLR-KARCHELLQKC-ELFERMSDLP 127
            ..|    |.|..  ..|..|.|:|.|..| :.....::::|. |.....||.:. |||:      
  Fly    62 FGD----GRTKDPIAYLAELASVASMLGFTIVGTLNLWKMLSLKTHFENLLNEFEELFQ------ 116

  Fly   128 VIKEIRQQVESTMNRYWASTRRQILIYLYSCICITTNYFINSFVINLY--RYFTKPKGSYDIMLP 190
            :||....::.....:|....|...:.:..:.:      :.||..|.|.  .:|:..: .....:.
  Fly   117 LIKHRAYRIHHYQEKYTRHIRNTFIFHTSAVV------YYNSLPILLMIREHFSNSQ-QLGYRIQ 174

  Fly   191 LPSLYPAWEHKGLEFPYYHIQMYLETCSLYIC--GMCA-------VSFDGVFIVLCLHSVGLMRS 246
            ..:.|| |:.:| ..|.:...:   .|.::.|  .||.       ::|.|  |.|.:|..||.|.
  Fly   175 SNTWYP-WQVQG-SIPGFFAAV---ACQIFSCQTNMCVNMFIQFLINFFG--IQLEIHFDGLARQ 232

  Fly   247 LNQMVEQATSELVPPDRRVEYLRCCIYQYQRVANFATEVNNCFRHITFTQFLLSLFNWGLALFQM 311
            |.      |.:...|..: :.|:..|..:.::.|.|..||..|   .|| ||:||          
  Fly   233 LE------TIDARNPHAK-DQLKYLIVYHTKLLNLADRVNRSF---NFT-FLISL---------- 276

  Fly   312 SVGLGNNSSITMIRMTMYLVAAGYQ-------IVVY----CYNGQRFATASEEIANAFYQVRWYG 365
            ||.:.:|..:. ..|||:......:       .:.|    |.:|......|.::..|.:...||.
  Fly   277 SVSMISNCFLA-FSMTMFDFGTSLKHLLGLLLFITYNFSMCRSGTHLILTSGKVLPAAFYNNWYE 340

  Fly   366 ESREFRHLIRMMLMRTNRGFRLDVSWFMQMSLPTLMAMVRTSGQYFLLLQNV 417
            ....:|.::.:::||..:.:.........:|:.|.||.::.|.|.|..::::
  Fly   341 GDLVYRRMLLILMMRATKPYMWKTYKLAPVSITTYMATLKFSYQMFTCVRSL 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 76/358 (21%)
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 75/350 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465359
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.