DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shab and KCNK17

DIOPT Version :10

Sequence 1:NP_001189037.1 Gene:Shab / 38352 FlyBaseID:FBgn0262593 Length:1607 Species:Drosophila melanogaster
Sequence 2:NP_113648.2 Gene:KCNK17 / 89822 HGNCID:14465 Length:332 Species:Homo sapiens


Alignment Length:47 Identity:13/47 - (27%)
Similarity:18/47 - (38%) Gaps:14/47 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 VFALQGDPLDWVSI----HRFH---------HQFTDSDRDPHSPIEG 149
            |..:|.| .||.|:    .|..         :.|.::...||.|.||
Human    60 VSTIQQD-ADWDSVLSSQQRMESENNKLCSLYSFRNTSTSPHKPDEG 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShabNP_001189037.1 BTB_POZ_Shab-like 306..414 CDD:349720
Ion_trans 464..700 CDD:459842
KCNK17NP_113648.2 Ion_trans_2 81..157 CDD:462301 6/25 (24%)
Selectivity filter 1. /evidence=ECO:0000250|UniProtKB:P57789 116..121
Ion_trans_2 <206..268 CDD:462301
Selectivity filter 2. /evidence=ECO:0000250|UniProtKB:P57789 221..226
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..312
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.