DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shab and TPK4

DIOPT Version :10

Sequence 1:NP_001189037.1 Gene:Shab / 38352 FlyBaseID:FBgn0262593 Length:1607 Species:Drosophila melanogaster
Sequence 2:NP_171752.1 Gene:TPK4 / 837846 AraportID:AT1G02510 Length:284 Species:Arabidopsis thaliana


Alignment Length:114 Identity:30/114 - (26%)
Similarity:55/114 - (48%) Gaps:5/114 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   609 LLMLFLAMGVLIFSSLAYFAEKDEKDTKFVSIPETFWWAGITMTTVGYGDIYPTTALGKVIGTVC 673
            ||:::|..||..:|    |.......|:.....:.|:::.:|.:|||||||.|:|:..|::..|.
plant    41 LLLVYLTFGVCTYS----FFRDQFSGTETNLFVDAFYFSIVTFSTVGYGDIVPSTSTTKILTIVL 101

  Fly   674 CICGVLVIALPIPIIVNNFAEFYKNQ-MRREKALKRREALDRAKREGSI 721
            ...||:.:...:..:|::.....:|. :.|....:.|...|....:|.|
plant   102 VSTGVVFLDYLLNRVVSHVLSLQENAILDRINKTRNRAIRDHIAEDGKI 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShabNP_001189037.1 BTB_POZ_Shab-like 306..414 CDD:349720
Ion_trans 464..700 CDD:459842 25/91 (27%)
TPK4NP_171752.1 PRK10537 <36..>108 CDD:236711 23/70 (33%)
Ion_trans_2 160..233 CDD:462301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.