DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shab and KCO1

DIOPT Version :10

Sequence 1:NP_001189037.1 Gene:Shab / 38352 FlyBaseID:FBgn0262593 Length:1607 Species:Drosophila melanogaster
Sequence 2:NP_200374.1 Gene:KCO1 / 835657 AraportID:AT5G55630 Length:363 Species:Arabidopsis thaliana


Alignment Length:132 Identity:28/132 - (21%)
Similarity:60/132 - (45%) Gaps:27/132 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   602 NSYKELGLLMLFLAMGVLIFSSLAYFAEKDEKDTKFVSIPETFWWAGITMTTVGYGDIYPTTALG 666
            |..:.:..|.|:|.:|.|.|    |.........|...:.:..::..:|||||||||:.|.::..
plant    75 NLRRVIMFLALYLTIGTLCF----YLVRDQISGHKTSGVVDALYFCIVTMTTVGYGDLVPNSSAS 135

  Fly   667 KVIGTVCCICGVLVIALPIPIIVNNFAEFYKNQMRREKALKRREALDRAKREGSIVSFHHINLKD 731
            :::.......|::::.    .:::..|::         .::::|||       .:.:||   |:.
plant   136 RLLACAFVFSGMVLVG----HLLSRAADY---------LVEKQEAL-------LVRAFH---LRQ 177

  Fly   732 AF 733
            :|
plant   178 SF 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShabNP_001189037.1 BTB_POZ_Shab-like 306..414 CDD:349720
Ion_trans 464..700 CDD:459842 21/97 (22%)
KCO1NP_200374.1 Ion_trans_2 81..163 CDD:462301 20/98 (20%)
Ion_trans_2 202..277 CDD:462301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.