DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shab and KCO3

DIOPT Version :9

Sequence 1:NP_001189037.1 Gene:Shab / 38352 FlyBaseID:FBgn0262593 Length:1607 Species:Drosophila melanogaster
Sequence 2:NP_001190480.1 Gene:KCO3 / 834679 AraportID:AT5G46360 Length:260 Species:Arabidopsis thaliana


Alignment Length:218 Identity:50/218 - (22%)
Similarity:79/218 - (36%) Gaps:79/218 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   551 SLFLL--ETNKNATDQFQDVRRVVQVFRIMRILRILKLARHSTGLQSLGFTLRNSYKELGLLMLF 613
            |||.|  ..:..|||...|......|.:        .:||.:                |.||:::
plant    37 SLFSLPEHNDDTATDMAPDQETEQSVSK--------SIARQA----------------LALLVVY 77

  Fly   614 LAMGVLIF-----SSLAYFAEKDEKDTKFVSIP-----------------------ETFWWAGIT 650
            |::||||:     |..||       .|..|::.                       ::|.::.:.
plant    78 LSLGVLIYWLTLDSDNAY-------QTHPVAVALYFFVVTFCGFLIVHFVVKIGWLDSFCFSVMM 135

  Fly   651 MTTVGYGDIYPTTALGKVIGTVCCICGVLVIALPIPIIVNNFAEFYKNQMRREKALKRREALDRA 715
            :||||:||....|.||..:..|..:...|.:|.         |..:....|.:|  :.||   ||
plant   136 VTTVGFGDRAFNTWLGTFLAAVWLLVSTLAVAR---------AFLFLADARADK--RNRE---RA 186

  Fly   716 KREGSIVSFHHINLKDAFAKSMD 738
            |:    |....|::...||..:|
plant   187 KK----VLGESISISQFFAADID 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShabNP_001189037.1 BTB 309..416 CDD:197585
BTB_2 309..408 CDD:280393
Ion_trans 501..700 CDD:278921 38/178 (21%)
Ion_trans_2 613..696 CDD:285168 24/110 (22%)
KCO3NP_001190480.1 Ion_trans_2 104..176 CDD:285168 14/80 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.