DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shab and kcna7

DIOPT Version :9

Sequence 1:NP_001189037.1 Gene:Shab / 38352 FlyBaseID:FBgn0262593 Length:1607 Species:Drosophila melanogaster
Sequence 2:XP_701294.4 Gene:kcna7 / 572481 ZFINID:ZDB-GENE-120215-257 Length:233 Species:Danio rerio


Alignment Length:193 Identity:58/193 - (30%)
Similarity:94/193 - (48%) Gaps:38/193 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 AVNSRVSINVGGVRHEVLWRTLERLPHTRLG----RLRECTTHEAIVELCDDYSLADNEYFFDRH 364
            |::.|::|||.|:|:|...|||.:.|.:.||    |||.             :....||.|.||:
Zfish    64 ALSERLAINVSGMRYETQIRTLAQFPDSLLGDPRRRLRY-------------FDPLRNEIFLDRN 115

  Fly   365 PKSFSSILNFYRT-GKLHIVDEMCVLAFSDDLEYWGVDELYLESCCQHKYHQRKENVHEEMRKEA 428
            ...|.:||.||:: |:|.....:.:..|.|:|.::.:.|..:.     ::.:.:....||.|...
Zfish   116 RFCFDAILYFYQSGGRLRRPANVPLDVFMDELRFYELGEDIMA-----RFKEDEGFPKEEPRPLP 175

  Fly   429 ESLRQRDEEEFGEGKCAEYQKYLWELLEKPNTSFAARVIAVISILFIVLSTIALTLNTLPQLQ 491
            ||               |:|:.:|.|.|.|.:|..||:||:||::.||:|.:...|.|||..:
Zfish   176 ES---------------EFQRKIWMLFEHPESSGGARIIAIISVMVIVVSILIFCLETLPDFR 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShabNP_001189037.1 BTB 309..416 CDD:197585 31/111 (28%)
BTB_2 309..408 CDD:280393 31/103 (30%)
Ion_trans 501..700 CDD:278921
Ion_trans_2 613..696 CDD:285168
kcna7XP_701294.4 BTB_2 71..160 CDD:280393 31/106 (29%)
BTB 71..158 CDD:197585 31/99 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.