DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shab and Kcnk6

DIOPT Version :10

Sequence 1:NP_001189037.1 Gene:Shab / 38352 FlyBaseID:FBgn0262593 Length:1607 Species:Drosophila melanogaster
Sequence 2:NP_001028697.2 Gene:Kcnk6 / 52150 MGIID:1891291 Length:313 Species:Mus musculus


Alignment Length:187 Identity:40/187 - (21%)
Similarity:70/187 - (37%) Gaps:47/187 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   524 SASPDKWKFFKGGLNIIDLLAILPYFVSLFLLETNKNATDQFQDVRRVVQ-VFRIMRI-LRILKL 586
            :||...|.|           |...:|.|..:.......|....|..:... ||.::.: :.:|.|
Mouse    85 NASDPAWDF-----------ASALFFASTLVTTVGYGYTTPLTDAGKAFSIVFALLGVPITMLLL 138

  Fly   587 ARHSTGLQSLGFTLRNS------------------YKELGLLMLFLAMGVLIFSSLAYFAEKDEK 633
               :...|.|...|.::                  :..:.|||:.:|:..|:  ..|.||..:|.
Mouse   139 ---TASAQRLSLLLTHAPLSWLSLHWGWPPQRAARWHLVALLMVIVAIFFLV--PAAVFAYLEEA 198

  Fly   634 DTKFVSIPETFWWAGITMTTVGYGDIYPTTALG-------KVIGTVCCICGVLVIAL 683
                .|..:.|::..|:::|:|.||..|..|.|       ||:.|.....|::.:.|
Mouse   199 ----WSFLDAFYFCFISLSTIGLGDYVPGEAPGQPYRALYKVLVTAYLFLGLVAMVL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShabNP_001189037.1 BTB_POZ_Shab-like 306..414 CDD:349720
Ion_trans 464..700 CDD:459842 40/187 (21%)
Kcnk6NP_001028697.2 Ion_trans_2 <89..146 CDD:462301 12/70 (17%)
Selectivity filter 1. /evidence=ECO:0000250|UniProtKB:P57789 106..111 0/4 (0%)
Ion_trans_2 180..259 CDD:462301 21/78 (27%)
Selectivity filter 2. /evidence=ECO:0000250|UniProtKB:P57789 214..219 2/4 (50%)
Lysosomal targeting signal. /evidence=ECO:0000250|UniProtKB:G3V8R8 282..290
Lysosomal targeting signal. /evidence=ECO:0000250|UniProtKB:G3V8R8 308..312
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.