DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shab and KCNK4

DIOPT Version :10

Sequence 1:NP_001189037.1 Gene:Shab / 38352 FlyBaseID:FBgn0262593 Length:1607 Species:Drosophila melanogaster
Sequence 2:NP_201567.1 Gene:KCNK4 / 50801 HGNCID:6279 Length:393 Species:Homo sapiens


Alignment Length:56 Identity:23/56 - (41%)
Similarity:26/56 - (46%) Gaps:7/56 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1039 LLSPLPAPLPPLHGPLLALPP---PPPLPPTSCA----AVLLPAISQSSSTSSSYG 1087
            ||.|.|.|..||..|....||   .||.|||:.|    :..|..|.:||.|.|..|
Human   303 LLPPPPCPAQPLGRPRSPSPPEKAQPPSPPTASALDYPSENLAFIDESSDTQSERG 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShabNP_001189037.1 BTB_POZ_Shab-like 306..414 CDD:349720
Ion_trans 464..700 CDD:459842
KCNK4NP_201567.1 Ion_trans_2 <88..142 CDD:462301
Selectivity filter 1. /evidence=ECO:0000269|PubMed:22282805, ECO:0000269|PubMed:23341632, ECO:0000269|PubMed:25471887, ECO:0000269|PubMed:25500157 103..108
Ion_trans_2 180..258 CDD:462301
Selectivity filter 2. /evidence=ECO:0000269|PubMed:22282805, ECO:0000269|PubMed:23341632, ECO:0000269|PubMed:25471887, ECO:0000269|PubMed:25500157 212..217
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 285..393 23/56 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.