DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shab and CG14647

DIOPT Version :9

Sequence 1:NP_001189037.1 Gene:Shab / 38352 FlyBaseID:FBgn0262593 Length:1607 Species:Drosophila melanogaster
Sequence 2:NP_649465.6 Gene:CG14647 / 40558 FlyBaseID:FBgn0037244 Length:335 Species:Drosophila melanogaster


Alignment Length:134 Identity:33/134 - (24%)
Similarity:57/134 - (42%) Gaps:26/134 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 SRSMSSIPPPEPFMIAQSKAVNSRVSINVGGVRHEVLWRTLERL----PHTRLGRLRECTTHEAI 345
            :|...:.|....|:.|...|.|..|.:||||   ::...|::.|    |.:.|.|:         
  Fly    12 ARKDDAAPAAGDFVAASGFAPNRWVKLNVGG---QIYATTIDTLVGREPDSMLARM--------- 64

  Fly   346 VELCDDYSLADNE------YFFDRHPKSFSSILNFYRTGKLHIVDEMCVLAFSDDLEYWGVDEL- 403
              ...:.|:..:|      |..||.|:.|..|:|:.|.|:......:.||...::..::|:..| 
  Fly    65 --FLQNGSMKPSERDEQGAYLIDRSPRYFEPIINYLRHGQFVCDSNISVLGVLEEARFFGIFSLV 127

  Fly   404 -YLE 406
             :||
  Fly   128 THLE 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShabNP_001189037.1 BTB 309..416 CDD:197585 27/110 (25%)
BTB_2 309..408 CDD:280393 27/110 (25%)
Ion_trans 501..700 CDD:278921
Ion_trans_2 613..696 CDD:285168
CG14647NP_649465.6 BTB 35..138 CDD:197585 27/111 (24%)
BTB 36..126 CDD:295341 24/103 (23%)
Pentapeptide_4 160..241 CDD:290330
Pentapeptide 166..202 CDD:279183
Pentapeptide 204..243 CDD:279183
Pentapeptide_4 248..321 CDD:290330
Pentapeptide 249..287 CDD:279183
Pentapeptide 284..322 CDD:279183
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.