DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shab and KCNK2

DIOPT Version :10

Sequence 1:NP_001189037.1 Gene:Shab / 38352 FlyBaseID:FBgn0262593 Length:1607 Species:Drosophila melanogaster
Sequence 2:NP_001017425.2 Gene:KCNK2 / 3776 HGNCID:6277 Length:426 Species:Homo sapiens


Alignment Length:120 Identity:28/120 - (23%)
Similarity:47/120 - (39%) Gaps:48/120 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   609 LLMLFLAMGVLIFSSLAYFAEKDEKDT------KFVS-------------------------IP- 641
            :::|:|.:|..:|.:|....|..::.|      .|:|                         || 
Human    68 VVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQIVAAINAGIIPL 132

  Fly   642 -------------ETFWWAGITMTTVGYGDIYPTTALGKVIGTVCCICGVLVIAL 683
                         .:|::||..:||:|:|:|.|.|..||:.   |.|..:|.|.|
Human   133 GNTSNQISHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIF---CIIYALLGIPL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShabNP_001189037.1 BTB_POZ_Shab-like 306..414 CDD:349720
Ion_trans 464..700 CDD:459842 28/120 (23%)
KCNK2NP_001017425.2 Important for GNG4 binding and L-glutamate release in astrocytes. /evidence=ECO:0000250|UniProtKB:Q920B6 17..38
Important for GNG4 binding and L-glutamate release in astrocytes. /evidence=ECO:0000250|UniProtKB:Q920B6 51..61
Ion_trans_2 <138..196 CDD:462301 17/50 (34%)
Selectivity filter 1. /evidence=ECO:0000250|UniProtKB:Q920B6 157..162 2/4 (50%)
Ion_trans_2 234..312 CDD:462301
Selectivity filter 2. /evidence=ECO:0000250|UniProtKB:Q920B6 266..271
Interaction with AKAP5. /evidence=ECO:0000250|UniProtKB:P97438 313..326
Essential for chloroform and halothane sensitivity. /evidence=ECO:0000250|UniProtKB:P97438 337..385
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.