DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shab and RpL37b

DIOPT Version :9

Sequence 1:NP_001189037.1 Gene:Shab / 38352 FlyBaseID:FBgn0262593 Length:1607 Species:Drosophila melanogaster
Sequence 2:NP_611757.1 Gene:RpL37b / 37669 FlyBaseID:FBgn0034822 Length:89 Species:Drosophila melanogaster


Alignment Length:104 Identity:21/104 - (20%)
Similarity:44/104 - (42%) Gaps:24/104 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   788 TEGESTSGRNPATTGTGCYKNYDHVANLRNSNLHNRRGSSSEQDAVPPYSFDNPNARQTSMMAME 852
            |:|.::.|:....|.|.|.:       ..||:.|.::...|:        ...|.|:..|.    
  Fly     2 TKGTTSFGKRHNKTHTICRR-------CGNSSYHLQKSKCSQ--------CGYPAAKTRSF---- 47

  Fly   853 SYRREQQALLQQQQQQQQQMLQMQQIQQKAPNG--NGGA 889
            ::.|:.:.   ::.|...:|..::.::::..||  .|||
  Fly    48 NWSRKAKG---RKAQGTGRMRYLKNLRRRFRNGLREGGA 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShabNP_001189037.1 BTB 309..416 CDD:197585
BTB_2 309..408 CDD:280393
Ion_trans 501..700 CDD:278921
Ion_trans_2 613..696 CDD:285168
RpL37bNP_611757.1 PTZ00073 1..89 CDD:240257 21/104 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.