DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shab and rpl-37.1

DIOPT Version :10

Sequence 1:NP_001189037.1 Gene:Shab / 38352 FlyBaseID:FBgn0262593 Length:1607 Species:Drosophila melanogaster
Sequence 2:NP_497072.1 Gene:rpl-37.1 / 175141 WormBaseID:WBGene00012179 Length:92 Species:Caenorhabditis elegans


Alignment Length:62 Identity:17/62 - (27%)
Similarity:22/62 - (35%) Gaps:10/62 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1220 SSGGPRAQVKKSASGDTALRNLAAGGVGAGGLSPLNDVYQSFDVQERGSRVSLNENSVPKHR 1281
            |.|.|.|:.:....|..::|...   .|.|....|.||...|       |....|.:.||.|
 Worm    36 SCGYPDAKKRTYNWGAKSIRRRT---TGTGRTRHLRDVNARF-------RNGFREGTTPKPR 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShabNP_001189037.1 BTB_POZ_Shab-like 306..414 CDD:349720
Ion_trans 464..700 CDD:459842
rpl-37.1NP_497072.1 PTZ00073 1..91 CDD:240257 17/62 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.