DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shab and F18A11.5

DIOPT Version :9

Sequence 1:NP_001189037.1 Gene:Shab / 38352 FlyBaseID:FBgn0262593 Length:1607 Species:Drosophila melanogaster
Sequence 2:NP_001254362.1 Gene:F18A11.5 / 174943 WormBaseID:WBGene00008932 Length:231 Species:Caenorhabditis elegans


Alignment Length:183 Identity:46/183 - (25%)
Similarity:67/183 - (36%) Gaps:56/183 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 VNSRVSINVGGVRHEVLWRTLERLPHTRLGRLRECTTHEAIVELCDDYSLADNEYFFDRHPKSFS 369
            ::.||.:||||.:.|....||.|:..|.|.           |.:.|.:...| |.|.||.||.|.
 Worm    18 LSERVLLNVGGKKFETTVATLTRVSDTVLA-----------VMVSDRWKTGD-EIFIDRDPKHFG 70

  Fly   370 SILNFYRTG----------------------KLHIVDEMCVLAFSD--DLEYWGVD--ELYLESC 408
            .:||:.|.|                      .:..:.|||:....|  |:..|..|  |:|....
 Worm    71 KVLNYLRDGDHFVAPSDTEACDELKREAHFYNMPFLAEMCMPMNVDVADVVQWKRDAIEIYWRPF 135

  Fly   409 CQHKYHQR-------KENVHEEMRKEAESLRQRDEEEFGEGKCAEYQKYLWEL 454
            .::.....       ..|.|...|..|       .|||.:.||:    ||:::
 Worm   136 VRYMVDDSLSLPFIYDRNNHTLARCIA-------CEEFQDPKCS----YLFDI 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShabNP_001189037.1 BTB 309..416 CDD:197585 34/132 (26%)
BTB_2 309..408 CDD:280393 34/124 (27%)
Ion_trans 501..700 CDD:278921
Ion_trans_2 613..696 CDD:285168
F18A11.5NP_001254362.1 BTB_POZ 22..102 CDD:365784 25/91 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.