DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shab and sup-9

DIOPT Version :10

Sequence 1:NP_001189037.1 Gene:Shab / 38352 FlyBaseID:FBgn0262593 Length:1607 Species:Drosophila melanogaster
Sequence 2:NP_494333.1 Gene:sup-9 / 173613 WormBaseID:WBGene00006318 Length:329 Species:Caenorhabditis elegans


Alignment Length:143 Identity:32/143 - (22%)
Similarity:56/143 - (39%) Gaps:41/143 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   601 RNSYKELGLL---MLFLAMGVLIFSSLAYFAE----------KDEKDTKF--------------- 637
            |.:.:.|.|:   :.:|.:|..:|.:|....|          :::..||:               
 Worm     3 RQNIRTLSLIVCTLTYLLVGAAVFDALETENEILQRKLVQRVREKLKTKYNMSNADYEILEATIV 67

  Fly   638 VSIPE----------TFWWAGITMTTVGYGDIYPTTALGKVIGTVCCICGV---LVIALPIPIIV 689
            .|:|.          .|::|...:||:|||...|.|..|||...:..:.|:   |::...|...:
 Worm    68 KSVPHKAGYQWKFSGAFYFATTVITTIGYGHSTPMTDAGKVFCMLYALAGIPLGLIMFQSIGERM 132

  Fly   690 NNFAEFYKNQMRR 702
            |.||......:||
 Worm   133 NTFAAKLLRFIRR 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShabNP_001189037.1 BTB_POZ_Shab-like 306..414 CDD:349720
Ion_trans 464..700 CDD:459842 30/139 (22%)
sup-9NP_494333.1 Ion_trans_2 <73..132 CDD:462301 15/58 (26%)
Ion_trans_2 168..242 CDD:462301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.