DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9970 and CG10752

DIOPT Version :9

Sequence 1:NP_647754.1 Gene:CG9970 / 38351 FlyBaseID:FBgn0035380 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_648614.1 Gene:CG10752 / 39467 FlyBaseID:FBgn0036325 Length:539 Species:Drosophila melanogaster


Alignment Length:384 Identity:89/384 - (23%)
Similarity:159/384 - (41%) Gaps:67/384 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 FSYVKSKPFIAEIPNLPPKISGPQLMTNILKSNYGALALVQIGENKFKCIPCLLRCFSVWFGIRD 176
            ::.:::..|..:|| |..|:.      ..|:.|.|..|.:.:.:..:||...:||.:...|....
  Fly    37 YNILRNAVFYKKIP-LQKKLK------LALERNIGPHAYIIVNDTIYKCQVFVLRIYCKLFTNNL 94

  Fly   177 WRITRFKFKEREVPSGGFKVVYEWMRTN--KLPEFDELVPALQVACHLKVTLLEKEIWQILSDES 239
            .|....||....:.:..|::.|.||..|  .||. |:::..|..|..|:...|.|.|::.|:|..
  Fly    95 KRGDIVKFPRDAMSNECFELAYTWMTNNAIHLPR-DKIINLLAAAKCLQCIPLIKRIFEFLNDYR 158

  Fly   240 VR-EKVAFLVYLGARRMPALGALCEAMLFRLRKYFLALVGSPHFVRLKVDVLEMLLRQDSIGVNS 303
            .. |..:|..||.|:.| .:..:.:.|:.|:.|.||.||.:..|:::.:|....|||...:.|.:
  Fly   159 THCELFSFSCYLKAKDM-GMTQVADMMVSRVTKSFLVLVSNGQFIKMDIDGACTLLRSRHLAVQN 222

  Fly   304 EMEVFFAVIRWLGHSRGRKRREHFQRLMKCVRFHHMPMTFLFSLRESFNHPEKFDLFSKEPGMLA 368
            |:|:|::.:.|| .|....|.::..|::..|||..:|..|:.....:..     ||         
  Fly   223 EIEIFYSALLWL-ISNYEMRIKYIPRVLSLVRFLMIPAVFILQWTSNLK-----DL--------- 272

  Fly   369 FNTDPEMMELLEHAIYFISVRTQCDDINEFLSTCESHHIEVVLPRWWVYHVNCPF---------- 423
               .||:..:|.|.::    .........:..|.:|..| :...|.|.....||:          
  Fly   273 ---RPELANVLCHFLH----NAMLSQFEYYTETFQSESI-IRGNRRWAQDPQCPYLSLFNANGDS 329

  Fly   424 ---------HLRTI-DFPYQHRFTAT---------DFGDYIDSIQKVWSGKGPPDDGKD 463
                     :||.| :.|  ..|.|.         :.||.: ::.:.|:.:...:|.|:
  Fly   330 DLSPDVFFRYLRQIQNSP--KSFVARLIMKDHMEYEIGDAL-TVNESWTSENSAEDLKE 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9970NP_647754.1 BACK 254..346 CDD:197943 27/91 (30%)
DUF4734 373..450 CDD:292506 19/105 (18%)
CG10752NP_648614.1 BACK 172..264 CDD:197943 28/93 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469520
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F9Z8
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006713
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22667
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.