DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9970 and CG30357

DIOPT Version :9

Sequence 1:NP_647754.1 Gene:CG9970 / 38351 FlyBaseID:FBgn0035380 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_724707.1 Gene:CG30357 / 246563 FlyBaseID:FBgn0050357 Length:451 Species:Drosophila melanogaster


Alignment Length:460 Identity:112/460 - (24%)
Similarity:186/460 - (40%) Gaps:71/460 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SSTKTLVREGESIPQDNNKSISSTIEEDLLQQNKSEKEKTKGTSTDKSTTTDGDLPTVKMDKILQ 77
            ||.|.::|   ......||.:.:..|.:.:|:...|.......:|..:.::..:|      ||..
  Fly    21 SSNKVILR---GYASKANKDVEAVEELEEIQEMNDELRDLFINTTAINCSSLSEL------KIQT 76

  Fly    78 QQRAELLWKTFTDEEYSDWKTFKDSNYKVPLLSVFSYVKSKPFIAEIPNLPPKISGPQLMTNILK 142
            .....|..:|.....||.....|               |||  |:::  |..|::..|.:.:::|
  Fly    77 DAFNTLKERTLFSLGYSTAGLLK---------------KSK--ISKV--LKGKVNLYQQIVSLVK 122

  Fly   143 SNYGALALVQIGENKFKCIPCLLRCFSVWFGIRDW-RITRFKFKEREVPSGGFKVVYEWM--RTN 204
            ......:.:.||:........:|:.||..|  ||. ........|:.:....|.::||||  .|.
  Fly   123 QRTKTNSEITIGKTSHPVHLMVLQSFSRMF--RDMGNDLSVALPEKMITPRSFGLIYEWMIEDTP 185

  Fly   205 KLPEFDELVPALQVACHLKVTLLEKEIWQILSDESVREKVAFLVYLGARRMPALGALCEAMLFRL 269
            .||... |:.....|..:::..|.::....| |....|..|.::|..|:.: .|..:....|.|:
  Fly   186 VLPRLG-LLEVFHAAKFMEIPQLVRQCKYCL-DHGFTEDSAAMLYFEAKIL-KLEVIHLQYLERV 247

  Fly   270 RKYFLALVGSPHFVRLKVDVLEMLLRQDSIGVNSEMEVFFAVIRWLGHSRGRKRREHFQRLMKCV 334
            .|:||.||.|..|:||.:..:.:|::.|.||||:|:|||.|..|||.| ...:|.|:...::..:
  Fly   248 SKFFLTLVASKEFLRLPLKSMLLLIQSDLIGVNTELEVFMAAARWLSH-HWPQREENVTDVVSSI 311

  Fly   335 RFHHMPMTFLFSLRESFNHPEKFDLFSKEPGMLAFNTDPEMMELLEHAIYFISVRT-QCDDINEF 398
            ||..:|...|..|       :|.|:.|...|.:.  ..|.:.:.:...|.:.:.|. ...|...|
  Fly   312 RFGLIPPWLLIRL-------QKPDVTSVGVGRIV--AQPIVRQAIHEGIAYTTTRMFYGKDREAF 367

  Fly   399 LSTCESHHIEVVLPRWWVYHVNCPFHLR-----TIDFPY------------QHRFTATDFGDYID 446
            ........::..:.|.|:|...||:|.|     |:|..|            |||       ||..
  Fly   368 KHYLHKACVKPPVQRTWIYDRKCPYHHRMQCRNTVDLTYDAFLEYLNYTQRQHR-------DYWK 425

  Fly   447 SIQKV 451
            |::.|
  Fly   426 SLEPV 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9970NP_647754.1 BACK 254..346 CDD:197943 33/91 (36%)
DUF4734 373..450 CDD:292506 21/94 (22%)
CG30357NP_724707.1 BTB 131..217 CDD:197585 21/89 (24%)
BTB <139..211 CDD:295341 18/74 (24%)
BACK 226..323 CDD:285009 35/98 (36%)
DUF4734 337..427 CDD:292506 20/98 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469522
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H119992
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006713
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22667
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.