DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tet and Cxxc5

DIOPT Version :9

Sequence 1:NP_001261344.1 Gene:Tet / 38347 FlyBaseID:FBgn0263392 Length:2921 Species:Drosophila melanogaster
Sequence 2:NP_001007629.1 Gene:Cxxc5 / 291670 RGDID:1359466 Length:316 Species:Rattus norvegicus


Alignment Length:308 Identity:81/308 - (26%)
Similarity:110/308 - (35%) Gaps:97/308 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   471 SYDGNNSNNSYPQAAGGGSGSHTPHTTTTQPTPTTTTPVKVEKLLQSPIAR------LEARKKER 529
            |.|...|::|...::..|||.....|..: .|...|.|..|......|..|      .|...|..
  Rat     8 SQDAGGSSSSSNTSSSSGSGQKAGGTDKS-ATVAATAPASVADDAPPPERRNKSGIISEPLNKSL 71

  Fly   530 RKQRPNSLESSAESE-----------------------------ASGMDVDPSNP------GQVD 559
            |:.||.|..||..|.                             |:.|.||.|||      |.|.
  Rat    72 RRSRPLSHYSSFGSSGGAGSMMGGESADKAAAAAASLLANGHDLAAAMAVDKSNPTSKHKSGAVA 136

  Fly   560 AVSSTANFKSPLSALGMGDSNDANASGCDKQDYGR---------RHHLP---------P------ 600
            ::.|.|...:.|:|.|.          ...|.:.:         :.|||         |      
  Rat   137 SLLSKAERATELAAEGQ----------LTLQQFAQSTEMLKRVVQEHLPLMSEAGAGLPDMEAVA 191

  Fly   601 -----------PTLNHPPMTLPPPTITITPT----THNHNHQNHNHNHSNDNNSSSCSLFQSKKK 650
                       |.|...|:.  |....:||.    ..:..|......:......:| ::...|||
  Rat   192 GAEALNGQSDFPYLGAFPIN--PGLFIMTPAGVFLAESALHMAGLAEYPMQGELAS-AISSGKKK 253

  Fly   651 RKRCGECVGCQRKDNCGECAPCRNDKS-HQICKQRRCEKLTEKKEPKA 697
            |||||.|..|:|:.||.:|:.|||.|: |||||.|:||:|  ||:|.|
  Rat   254 RKRCGMCAPCRRRINCEQCSSCRNRKTGHQICKFRKCEEL--KKKPSA 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TetNP_001261344.1 zf-CXXC 646..686 CDD:251032 24/40 (60%)
Tet_JBP 1857..>1990 CDD:289611
Tet_JBP <2676..2727 CDD:289611
Cxxc5NP_001007629.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..95 23/87 (26%)
zf-CXXC 249..290 CDD:366873 24/40 (60%)
Nuclear localization signal. /evidence=ECO:0000255 251..256 4/4 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.