DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant6 and GALNT3

DIOPT Version :9

Sequence 1:NP_001261342.1 Gene:Pgant6 / 38346 FlyBaseID:FBgn0035375 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_004473.2 Gene:GALNT3 / 2591 HGNCID:4125 Length:633 Species:Homo sapiens


Alignment Length:585 Identity:200/585 - (34%)
Similarity:286/585 - (48%) Gaps:112/585 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DVKVKVPAIKQPEPQKPQEPDFEEDPELQKIDEPEPVEEEVDNPHPADDEPQQQPQEELQMAAPA 120
            ::|..:|.::...|.: |..|..|.|.||.......::..:|.|          ||:.   .||.
Human    72 NIKDAMPKMQIGAPVR-QNIDAGERPCLQGYYTAAELKPVLDRP----------PQDS---NAPG 122

  Fly   121 DASVKKDWHDYTFMEKDAKRVGLGEGGKASTLDDESQRDLEKRMSLENGFNALLSDSISVNRSV- 184
            .:                     |:..|.:.|..|.|::.| |...::.|||..||.||::|.: 
Human   123 AS---------------------GKAFKTTNLSVEEQKEKE-RGEAKHCFNAFASDRISLHRDLG 165

  Fly   185 PDIRHPLCRKKEY--VAKLPTVSVIIIFYNEYLSVLMRSVHSLINRSPPELMKEIILVDDHSDRE 247
            ||.|.|.|.::::  ...|||.||||:|:||..|.|:|:|||::..||..|:||||||||.|..|
Human   166 PDTRPPECIEQKFKRCPPLPTTSVIIVFHNEAWSTLLRTVHSVLYSSPAILLKEIILVDDASVDE 230

  Fly   248 YLGKELETYIAEHFKWVRVVRLPRRTGLIGARAAGARNATAEVLIFLDSHVEANYNWLPPLLEPI 312
            ||..:|:.|: :.|..|::||...|.|||.||..||..||||.|.|||:|.|..|.||.|||..|
Human   231 YLHDKLDEYV-KQFSIVKIVRQRERKGLITARLLGATVATAETLTFLDAHCECFYGWLEPLLARI 294

  Fly   313 ALNKRTAVCPFIDVIDHTNFHY-RAQDEGA---RGAFDW--EFFYKRLPLLPEDLKHPAD---PF 368
            |.|....|.|.|..||...|.: :....|:   ||.|||  .|.::.||  ..:.:...|   |.
Human   295 AENYTAVVSPDIASIDLNTFEFNKPSPYGSNHNRGNFDWSLSFGWESLP--DHEKQRRKDETYPI 357

  Fly   369 KSPIMAGGLFAISREFFWELGGYDEGLDIWGGEQYELSFKIWMCGGEMYDAPCSRIGHIYRGPRN 433
            |:|..|||||:||:|:|..:|.|||.::|||||..|:||::|.|||::...|||.:||::|....
Human   358 KTPTFAGGLFSISKEYFEYIGSYDEEMEIWGGENIEMSFRVWQCGGQLEIMPCSVVGHVFRSKSP 422

  Fly   434 HQPSPRKGDYLHKNYKRVAEVWMDEYKNYLYSHGDGLYESVDP---GDLTEQKAIRTKLNCKSFK 495
            |. .|:....:.:|..|:|||||||||...|.......:.|..   |||:::..|:.:|.||:|.
Human   423 HS-FPKGTQVIARNQVRLAEVWMDEYKEIFYRRNTDAAKIVKQKAFGDLSKRFEIKHRLQCKNFT 486

  Fly   496 WFMEEVAFDLMKTYPPVDPPS---YAMGALQNVGNQNLCLDTLGRKKHNKMGMYACADNIKTPQR 557
            |::..:       ||.|..|.   ...|.:::|| |.||||.    ..|..|             
Human   487 WYLNNI-------YPEVYVPDLNPVISGYIKSVG-QPLCLDV----GENNQG------------- 526

  Fly   558 TQFWELSWKRDLRLRRKKECLDVQIWDANAPVWLWDCHSQGGNQYWYYDYRHKQLKHGTEGRRCL 622
                                        ..|:.::.||..|||||:.|..:| :::|..:...||
Human   527 ----------------------------GKPLIMYTCHGLGGNQYFEYSAQH-EIRHNIQKELCL 562

  Fly   623  622
            Human   563  562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant6NP_001261342.1 BcsA 199..>413 CDD:224136 105/222 (47%)
pp-GalNAc-T 205..502 CDD:133004 135/308 (44%)
RICIN 520..647 CDD:238092 23/103 (22%)
Ricin_B_lectin 520..645 CDD:279046 23/103 (22%)
GALNT3NP_004473.2 Catalytic subdomain A 184..293 61/109 (56%)
pp-GalNAc-T 188..493 CDD:133004 135/315 (43%)
Catalytic subdomain B 356..418 33/61 (54%)
Ricin_B_lectin 506..627 CDD:306998 23/104 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.