DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS35 and AT4G21460

DIOPT Version :9

Sequence 1:NP_523893.1 Gene:mRpS35 / 38345 FlyBaseID:FBgn0035374 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001328638.1 Gene:AT4G21460 / 827418 AraportID:AT4G21460 Length:428 Species:Arabidopsis thaliana


Alignment Length:318 Identity:59/318 - (18%)
Similarity:110/318 - (34%) Gaps:100/318 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTRLLERLPLKKQTAQSGI-----RVFSNQEQRQEIEDDEEFRVLSLRTVKQQMQKRQQVRRDPI 64
            |...:|.||.|........     ...|..|:.:::.:..|:       |.::|:|::....|  
plant   130 LMEKIESLPFKDDVKDEDFESDFEEAHSTDEELEDLYNSPEY-------VAEKMRKKEFFNMD-- 185

  Fly    65 TPPRTGRMAVDQDWTAVWPGPRSFHPASVPLPLRQGFTERGAAAPSKFANAELMKIPNFLHLTPP 129
                      |..|..:               :|:|. :.|....:|.....|..:..:..|.|.
plant   186 ----------DNKWDHM---------------IREGI-QHGCLTDTKQCEEILEDMLKWDQLLPD 224

  Fly   130 AIRQQCEAIKKF------CTPWPKG-LETEAKWQ--RHFPLEVT-------------------TT 166
            .::::.||  ||      |   .:| :|.||.::  :.|..|:.                   |:
plant   225 DLKKKVEA--KFNELGDMC---ERGEIEAEAAYELFKEFEDEMVIQYGDQMEAEGPPQFGETDTS 284

  Fly   167 DYCQSL-------PTIR--------------NPEARRVTITLKLSDLKFDAHARDKFLRLVGDRY 210
            |....|       |.:|              :|:.|:|.:::.:.:|....|...:...|||.||
plant   285 DRNTDLDDPSGKGPILRWQSRIVFAPGGDAWHPKNRKVKMSVTVKELGLSNHQAKRLRELVGKRY 349

  Fly   211 NKDTDLVTFVTDRCPQKKQNYDYALYLLTACYHESFVTEPWEATKSEADMEV-YLFER 267
            :...|.:|...:|...:::|....|..|     ...:.|..:|.|...|:.. |:.:|
plant   350 HSGKDELTITCERFEHREENRKDCLRTL-----YGLIEEAGKANKIAEDIRTSYVKQR 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS35NP_523893.1 MRP-S28 160..281 CDD:287217 28/149 (19%)
AT4G21460NP_001328638.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3933
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13490
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.