DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS35 and AT3G18240

DIOPT Version :9

Sequence 1:NP_523893.1 Gene:mRpS35 / 38345 FlyBaseID:FBgn0035374 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_566603.1 Gene:AT3G18240 / 821352 AraportID:AT3G18240 Length:419 Species:Arabidopsis thaliana


Alignment Length:318 Identity:58/318 - (18%)
Similarity:109/318 - (34%) Gaps:100/318 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTRLLERLPLKKQTAQSGI-----RVFSNQEQRQEIEDDEEFRVLSLRTVKQQMQKRQQVRRDPI 64
            |...:|.||.|........     ...|..|:.:::.:..|:       |.::|:|.:....|  
plant   121 LLEKIESLPFKDDVKDEDFESDFEEAHSTDEELEDLYNSPEY-------VAEKMRKNEFFNMD-- 176

  Fly    65 TPPRTGRMAVDQDWTAVWPGPRSFHPASVPLPLRQGFTERGAAAPSKFANAELMKIPNFLHLTPP 129
                      |:.|..:               :|:|. :.|....:|.....|..:..:..|.|.
plant   177 ----------DKKWDHM---------------IREGI-QHGCLTDTKECEEILEDMLKWDQLLPD 215

  Fly   130 AIRQQCEAIKKF------CTPWPKG-LETEAKWQ--RHF----------------PLEVTTTDYC 169
            .::::.||  ||      |   .:| :|.||.::  :.|                |.:...||..
plant   216 DLKKKVEA--KFNELGDMC---ERGEIEAEAAYELFKEFEDEMVIQYGDQMEAEGPPQFGETDAS 275

  Fly   170 Q----------SLPTIR--------------NPEARRVTITLKLSDLKFDAHARDKFLRLVGDRY 210
            .          ..|.:|              :|:.|:|.:::.:.:|....|...:...|||.||
plant   276 DRNTDLDDPPGKGPILRWQSRIVFAPGGDAWHPKNRKVKMSVTVKELGLSKHQAKRLRELVGKRY 340

  Fly   211 NKDTDLVTFVTDRCPQKKQNYDYALYLLTACYHESFVTEPWEATKSEADMEV-YLFER 267
            :...|.:|..::|...:::|....|..|     ...:.|..:|.|...|:.. |:.:|
plant   341 HSGKDELTITSERFEHREENRKDCLRTL-----YGLIEEAGKANKIAEDIRTSYVKQR 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS35NP_523893.1 MRP-S28 160..281 CDD:287217 27/133 (20%)
AT3G18240NP_566603.1 PCRF 284..>385 CDD:424301 21/105 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3933
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13490
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.