DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS35 and mrps35

DIOPT Version :9

Sequence 1:NP_523893.1 Gene:mRpS35 / 38345 FlyBaseID:FBgn0035374 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001016014.1 Gene:mrps35 / 548768 XenbaseID:XB-GENE-1017075 Length:326 Species:Xenopus tropicalis


Alignment Length:278 Identity:121/278 - (43%)
Similarity:176/278 - (63%) Gaps:6/278 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 QKRQQVRRDPITPPRTGRMAVDQDWTAVWPGPRSFHPASVPLPLRQGFTERGAAAPSKFANAELM 118
            |::...||: ..||||.:|..||||.:|:|....|.|::||||:|.|:..:....|.|..|.||:
 Frog    50 QQKNLFRRE-AAPPRTEKMLPDQDWCSVYPTAAPFKPSAVPLPVRMGYPVKRGVPPEKTGNLELI 113

  Fly   119 KIPNFLHLTPPAIRQQCEAIKKFCTPWPKGLETEAKWQRHFPLEVTTTDYCQSLPTIRNPEARRV 183
            ||||||||||.||:..|.|:|:|||.||..|.::...:::||:...|.||..:.|::|||:||.|
 Frog   114 KIPNFLHLTPVAIKNHCAALKEFCTQWPSALSSDELCEKNFPINFQTLDYVSAGPSLRNPKARVV 178

  Fly   184 TITLKLSDLKFDAHARDKFLRLVGDRYNKDTDLVTFVTDRCPQKKQNYDYALYLLTACYHESFVT 248
            ::.:|||.|..|.|:|.|.::|.|.||:..||.:|..:||||.::||.||.|||||..||||:.|
 Frog   179 SMQVKLSSLNLDDHSRKKLIKLAGPRYDSTTDTLTLRSDRCPVRRQNRDYTLYLLTVLYHESWKT 243

  Fly   249 EPWEATKSEADMEVYLFERNQSKVSAEGILNWNAKKGAP--KVVPS---KSFAECVEKLINEGEN 308
            |.||:.|.|:|||.|::|.::|:.:|...|........|  :::.|   :.:...:..|.|:||.
 Frog   244 EAWESEKEESDMEAYVWEGSRSEKNALETLLRGRYSSTPQEQILQSPAVQQYRNAMLNLRNQGEQ 308

  Fly   309 EYNLGKYKEEVKKMLNIA 326
            |.::..||:.||.||.||
 Frog   309 EESIENYKQSVKSMLGIA 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS35NP_523893.1 MRP-S28 160..281 CDD:287217 57/120 (48%)
mrps35NP_001016014.1 MRP-S28 155..>240 CDD:393435 41/84 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 108 1.000 Domainoid score I6379
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11048
Inparanoid 1 1.050 245 1.000 Inparanoid score I3212
OMA 1 1.010 - - QHG45674
OrthoDB 1 1.010 - - D1339087at2759
OrthoFinder 1 1.000 - - FOG0007228
OrthoInspector 1 1.000 - - oto103080
Panther 1 1.100 - - LDO PTHR13490
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5333
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.