DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS35 and mrps35

DIOPT Version :9

Sequence 1:NP_523893.1 Gene:mRpS35 / 38345 FlyBaseID:FBgn0035374 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001026839.1 Gene:mrps35 / 503880 ZFINID:ZDB-GENE-050809-131 Length:330 Species:Danio rerio


Alignment Length:284 Identity:129/284 - (45%)
Similarity:176/284 - (61%) Gaps:15/284 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VKQQMQKRQQVRRDPITPPRTGRMAVDQDWTAVWPGPRSFHPASVPLPLRQGFTERGAAAPSKFA 113
            |:.||:.|:|...     |||.|||||||||||:|...||.|::||||:|.|:.......|:|..
Zfish    55 VRGQMKPRRQAGE-----PRTERMAVDQDWTAVYPTAASFKPSAVPLPVRMGYPVNRGVPPAKHG 114

  Fly   114 NAELMKIPNFLHLTPPAIRQQCEAIKKFCTPWPKGLETEAKWQRHFPLEVTTTDYCQSLPTIRNP 178
            |.||:||||||||||..|::.|||:|.|.|.||..|:::.|...|||::|.:.|:..|..::|||
Zfish   115 NLELIKIPNFLHLTPATIKKHCEALKPFLTEWPSALDSDEKCTEHFPIQVQSKDFVSSGLSLRNP 179

  Fly   179 EARRVTITLKLSDLKFDAHARDKFLRLVGDRYNKDTDLVTFVTDRCPQKKQNYDYALYLLTACYH 243
            :||.||:.:|.|.|..|.|||.|.::|...||.|:||.:|..||.||.::||||||:||||..||
Zfish   180 DARIVTLKVKHSSLNLDDHARKKMIKLAEKRYCKETDTLTITTDSCPLRQQNYDYAMYLLTVLYH 244

  Fly   244 ESFVTEPWEATKSEADMEVYLFERNQSK-------VSAEGILNWNAKKGAPKVVPSKSFAECVEK 301
            ||:.:|.||..|:.||||.|.::.:.|:       .|..|....:.....|:|   ..:...|.:
Zfish   245 ESWKSEAWEQEKTRADMEEYEWQDSPSQRNILETLKSIRGTEETHELLDQPEV---GEYRNSVTQ 306

  Fly   302 LINEGENEYNLGKYKEEVKKMLNI 325
            :.|.||.|.||.:|||.|||:|.:
Zfish   307 MKNHGETEENLLRYKEAVKKLLQL 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS35NP_523893.1 MRP-S28 160..281 CDD:287217 56/127 (44%)
mrps35NP_001026839.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..73 8/22 (36%)
MRP-S28 178..274 CDD:287217 49/95 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586323
Domainoid 1 1.000 118 1.000 Domainoid score I5839
eggNOG 1 0.900 - - E1_KOG3933
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11048
Inparanoid 1 1.050 248 1.000 Inparanoid score I3241
OMA 1 1.010 - - QHG45674
OrthoDB 1 1.010 - - D1339087at2759
OrthoFinder 1 1.000 - - FOG0007228
OrthoInspector 1 1.000 - - oto38876
orthoMCL 1 0.900 - - OOG6_107549
Panther 1 1.100 - - LDO PTHR13490
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5333
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.