DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS35 and rsm24

DIOPT Version :9

Sequence 1:NP_523893.1 Gene:mRpS35 / 38345 FlyBaseID:FBgn0035374 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_592985.1 Gene:rsm24 / 2541429 PomBaseID:SPAC2F7.15 Length:258 Species:Schizosaccharomyces pombe


Alignment Length:205 Identity:45/205 - (21%)
Similarity:80/205 - (39%) Gaps:47/205 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 QQCEAIKKF----------CTPWPKGLETEAKWQ-RHFPLEVTTTDYCQSLPTIRNPEARRVTIT 186
            |:.|.|::.          .||:.:..:..|..| ..|..:|..:.:.:..|        :|.:|
pombe    78 QEHEVIRELYRKAAYELPGLTPYTQSFKKPADSQIFRFESDVQMSSFEKMNP--------KVVVT 134

  Fly   187 LKLSDLKFDAHARDKFLR-LVGDRYNKDTDLVTFVTDRCPQKKQNYDYALYLLTACYHESFVTEP 250
            .|::::......:...|| |||.|||.:.|||...:|:.....||..:.:.:||:...||     
pombe   135 FKVTNIPLLEEKQRHVLRLLVGPRYNPEEDLVRISSDKYSSALQNKYHLIKILTSLIEES----- 194

  Fly   251 WEATKSEADMEVYLFERNQSKVSAEGIL--NWNAKKGAPKVVPSKSFAECV----EKLINEGENE 309
                           :||..|.|...:.  :|..|| ..|.:|.:..|:..    :|....|:..
pombe   195 ---------------KRNAEKFSHVPLNTGHWKYKK-CDKRMPQEWLADATTLTSKKKTTIGKQS 243

  Fly   310 YNLGKYKEEV 319
            :|....:|.:
pombe   244 HNTVLERESI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS35NP_523893.1 MRP-S28 160..281 CDD:287217 27/123 (22%)
rsm24NP_592985.1 MRP-S28 103..225 CDD:287217 35/150 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3933
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13490
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.