DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS35 and Mrps35

DIOPT Version :9

Sequence 1:NP_523893.1 Gene:mRpS35 / 38345 FlyBaseID:FBgn0035374 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_663548.2 Gene:Mrps35 / 232536 MGIID:2385255 Length:320 Species:Mus musculus


Alignment Length:284 Identity:133/284 - (46%)
Similarity:191/284 - (67%) Gaps:14/284 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 QKRQQVRRDPITPPRTGRMAVDQDWTAVWPGPRSFHPASVPLPLRQGFTERGAAAPSKFANAELM 118
            :..:.:||..: ||||.:|..||||.:|:|....|.|::||||:|.|:..:.....:|..|.||:
Mouse    40 RSERPMRRKAL-PPRTEKMDTDQDWPSVYPTAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNLELL 103

  Fly   119 KIPNFLHLTPPAIRQQCEAIKKFCTPWPKGLETEAKWQRHFPLEVTTTDYCQSLPTIRNPEARRV 183
            ||||||||||.||::.|.|:|.|||.||..|:::.|.:.|||:|:.|.||..|.|:||||:||.|
Mouse   104 KIPNFLHLTPVAIKRHCAALKDFCTEWPAALDSDEKCEEHFPVEIDTADYVSSGPSIRNPKARAV 168

  Fly   184 TITLKLSDLKFDAHARDKFLRLVGDRYNKDTDLVTFVTDRCPQKKQNYDYALYLLTACYHESFVT 248
            |:.:|||.|..|.||:.|.::|||:||.|.||::|..|||||.|:||.|||:||||..||||:.|
Mouse   169 TLRVKLSSLNLDNHAKKKLIKLVGERYCKATDVLTITTDRCPLKRQNCDYAVYLLTVLYHESWKT 233

  Fly   249 EPWEATKSEADMEVYLFERNQSKVSA-EGILNWNAKKGAPKVVPSK----------SFAECVEKL 302
            |.||.:|:|.||:.|::.::.|:.|. :.:|...|.:.:  |.||:          .:.:|:.:|
Mouse   234 EDWENSKTEEDMDEYVWAKSSSENSVLQTLLQMRAAESS--VAPSREELLGTKEVEDYQKCIVRL 296

  Fly   303 INEGENEYNLGKYKEEVKKMLNIA 326
            .||||||.:|.:|||.||::||:|
Mouse   297 KNEGENEASLAQYKESVKRLLNLA 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS35NP_523893.1 MRP-S28 160..281 CDD:287217 63/121 (52%)
Mrps35NP_663548.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..63 9/23 (39%)
MRP-S28 162..248 CDD:287217 50/85 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841853
Domainoid 1 1.000 130 1.000 Domainoid score I5210
eggNOG 1 0.900 - - E1_KOG3933
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11048
Inparanoid 1 1.050 275 1.000 Inparanoid score I2944
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45674
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007228
OrthoInspector 1 1.000 - - oto92810
orthoMCL 1 0.900 - - OOG6_107549
Panther 1 1.100 - - LDO PTHR13490
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4329
SonicParanoid 1 1.000 - - X5333
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.